KEGG   Mus musculus (mouse): 83770
Entry
83770             CDS       T01002                                 

Gene name
Tas1r2, Gpr, Gpr71, T1r, T1r2, TR, TR2
Definition
(RefSeq) taste receptor, type 1, member 2
  KO
K04625  taste receptor type 1 member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04742  Taste transduction
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    83770 (Tas1r2)
  09157 Sensory system
   04742 Taste transduction
    83770 (Tas1r2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    83770 (Tas1r2)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Taste
    83770 (Tas1r2)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Ephrin_rec_like
Other DBs
NCBI-GeneID: 83770
NCBI-ProteinID: NP_114079
MGI: 1933546
Ensembl: ENSMUSG00000028738
Vega: OTTMUSG00000010062
UniProt: Q925I4
Position
4 D3; 4 70.82 cM
AA seq 843 aa
MGPQARTLHLLFLLLHALPKPVMLVGNSDFHLAGDYLLGGLFTLHANVKSVSHLSYLQVP
KCNEYNMKVLGYNLMQAMRFAVEEINNCSSLLPGVLLGYEMVDVCYLSNNIQPGLYFLSQ
IDDFLPILKDYSQYRPQVVAVIGPDNSESAITVSNILSYFLVPQVTYSAITDKLRDKRRF
PAMLRTVPSATHHIEAMVQLMVHFQWNWIVVLVSDDDYGRENSHLLSQRLTNTGDICIAF
QEVLPVPEPNQAVRPEEQDQLDNILDKLRRTSARVVVIFSPELSLHNFFREVLRWNFTGF
VWIASESWAIDPVLHNLTELRHTGTFLGVTIQRVSIPGFSQFRVRHDKPEYPMPNETSLR
TTCNQDCDACMNITESFNNVLMLSGERVVYSVYSAVYAVAHTLHRLLHCNQVRCTKQIVY
PWQLLREIWHVNFTLLGNQLFFDEQGDMPMLLDIIQWQWGLSQNPFQSIASYSPTETRLT
YISNVSWYTPNNTVPISMCSKSCQPGQMKKPIGLHPCCFECVDCPPGTYLNRSVDEFNCL
SCPGSMWSYKNNIACFKRRLAFLEWHEVPTIVVTILAALGFISTLAILLIFWRHFQTPMV
RSAGGPMCFLMLVPLLLAFGMVPVYVGPPTVFSCFCRQAFFTVCFSVCLSCITVRSFQIV
CVFKMARRLPSAYGFWMRYHGPYVFVAFITAVKVALVAGNMLATTINPIGRTDPDDPNII
ILSCHPNYRNGLLFNTSMDLLLSVLGFSFAYVGKELPTNYNEAKFITLSMTFSFTSSISL
CTFMSVHDGVLVTIMDLLVTVLNFLAIGLGYFGPKCYMILFYPERNTSAYFNSMIQGYTM
RKS
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgggaccccaggcgaggacactccatttgctgtttctcctgctgcatgctctgcctaag
ccagtcatgctggtagggaactccgactttcacctggctggggactacctcctgggtggc
ctctttaccctccatgccaacgtgaagagcgtctctcacctcagctacctgcaggtgccc
aagtgcaatgagtacaacatgaaggtcttgggctacaacctcatgcaggccatgcgattc
gccgtggaggaaatcaacaactgtagctctctgctgcccggcgtgctgctcggctacgag
atggtggatgtctgctacctctccaacaatatccagcctgggctctacttcctgtcacag
atagatgacttcctgcccatcctcaaagactacagccagtacaggccccaagtggtggcc
gtcattggcccagacaactctgagtccgccatcaccgtgtccaacattctctcctacttc
ctcgtgccacaggtcacatatagcgccatcaccgacaagctgcgagacaagcggcgcttc
cctgccatgctgcgcactgtgcccagcgccacccaccacatcgaggccatggtgcaactg
atggttcacttccagtggaactggatcgtggtgctggtgagcgatgacgattatggccga
gagaacagccacctgctgagccagcgtctgaccaacactggcgatatctgcattgccttc
caggaggttctgcctgtaccagaacccaaccaggccgtgaggcctgaggagcaggaccaa
ctggacaacatcctggacaagctgcggcggacctcggcgcgtgtggtggtgatattctcg
ccagagctgagcctgcacaacttcttccgcgaggtgctgcgctggaacttcacaggcttt
gtgtggattgcctctgagtcctgggccatcgaccctgttctacacaacctcacagagctg
cgccacacgggcactttcctgggcgtcaccatccagagggtgtccatccctggcttcagc
cagttccgagtgcgccacgacaagccagagtatcccatgcctaacgagaccagcctgagg
actacctgtaaccaggactgtgacgcctgcatgaacatcaccgagtcctttaacaacgtt
ctcatgctttcgggggagcgtgtggtctacagtgtgtactcggccgtctacgcggtagcc
cacaccctccacagactcctccactgcaaccaggtccgctgcaccaagcaaatcgtctat
ccatggcagctactcagggagatctggcatgtcaacttcacgctcctgggcaaccagctc
ttcttcgacgaacaaggggacatgccgatgctcctggacatcatccagtggcaatggggc
ctgagccagaaccccttccaaagcatcgcctcctactcccccaccgagacgaggctgacc
tacattagcaatgtgtcctggtacacccccaacaacacggtccccatatccatgtgttct
aagagttgccagcctgggcaaatgaaaaaacccataggcctccacccgtgctgcttcgag
tgtgtggactgtccgccgggcacctacctcaaccgatcagtagatgagtttaactgtctg
tcctgcccgggttccatgtggtcttacaagaacaacatcgcttgcttcaagcggcggctg
gccttcctggagtggcacgaagtgcccactatcgtggtgaccatcctggccgccctgggc
ttcatcagtacgctggccattctgctcatcttctggagacatttccagacgcccatggtg
cgctcggcgggcggccccatgtgcttcctgatgctggtgcccctgctgctggcgttcggg
atggtccccgtgtatgtgggcccccccacggtcttctcctgtttctgccgccaggctttc
ttcaccgtttgcttctccgtctgcctctcctgcatcacggtgcgctccttccagattgtg
tgcgtcttcaagatggccagacgcctgccaagcgcctacggtttctggatgcgttaccac
gggccctacgtctttgtggccttcatcacggccgtcaaggtggccctggtggcaggcaac
atgctggccaccaccatcaaccccattggccggaccgaccccgatgaccccaatatcata
atcctctcctgccaccctaactaccgcaacgggctactcttcaacaccagcatggacttg
ctgctgtccgtgctgggtttcagcttcgcgtacgtgggcaaggaactgcccaccaactac
aacgaagccaagttcatcaccctcagcatgaccttctccttcacctcctccatctccctc
tgcacgttcatgtctgtccacgatggcgtgctggtcaccatcatggatctcctggtcact
gtgctcaactttctggccatcggcttggggtactttggccccaagtgttacatgatcctt
ttctacccggagcgcaacacttcagcttatttcaatagcatgattcagggctacacgatg
aggaagagctag

DBGET integrated database retrieval system