KEGG   Mus musculus (house mouse): 83813
Entry
83813             CDS       T01002                                 
Symbol
Tnk1, Kos1, Tnk1a, Tnk1b
Name
(RefSeq) tyrosine kinase, non-receptor, 1
  KO
K08885  non-receptor tyrosine-protein kinase TNK1 [EC:2.7.10.2]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    83813 (Tnk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     83813 (Tnk1)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  ACK family
   83813 (Tnk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase HOIP-UBA UBA_4 SH3_1 SH3_9
Other DBs
NCBI-GeneID: 83813
NCBI-ProteinID: NP_114086
MGI: 1930958
Ensembl: ENSMUSG00000001583
UniProt: Q99ML2 Q3TJU8
Position
11:complement(69741389..69749556)
AA seq 666 aa
MLPEASSLWLLRLLRDVQLAQFYRPILEELNVTRPEHFDFVRPEDLDNIGMGRPAQRRLN
EALKRYRSGVKSKNWVYKILGGFAPEQKEIPPRSDSPLCFHEPEGGLKCLIPEGAVRRGE
LLGSGCFGVVHRGLWTLPSGQSIPVAVKSLRVGPEGPMGTELGDFLREVSVMMKLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLPVALLCLFLRQLAGAMAYLGSCG
LVHRDLATRNLLLASPRMIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRQGAF
SSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEKDRARLPKPPLCSRALYSLALRC
WAPHPADRPSFSNLEGLLQEAWLSEGRCVREVTEPGALRMEPGDPITIIEGSLDTATWKG
QNGRTLKVGNFPASAVTLADLGGSPVTHPAHRGSPAHGEKCRGGTDGDREKATLQDLPPA
RSHRTKMPLQRMRGISKSLESVLSLGPRPTGGGSSPPELRRTRAMPQRLPDLPPRPPDLP
PRPPIICNSSQPTQPHKARPKRESSHNHRTGAPGASKATVPSGGPLSDPEWQRKVVEVEL
SVHGVTYQECQVALRTTGGDVASAIRNLKVDQLFHLSNRSRADCRRILEHHQWDLSAASR
YILARS
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgctccctgaagccagttccctgtggctccttcggctactccgggatgttcaactggcc
cagttttaccggcccatccttgaggaactcaacgtcactcggccagaacattttgacttt
gtaaggcctgaggacctggacaacataggcatgggcaggcctgcccagcgcagacttaat
gaagccctgaagaggtaccggtcaggggtcaagtccaagaattgggtgtacaagatactt
gggggctttgctcccgaacagaaggagatccctccacgctcagacagtcctctgtgcttc
catgagccagaggggggactcaagtgtctgattccagagggtgctgtgcgcagaggggag
ctgctgggttcaggctgctttggtgttgtacatcgagggttatggacactacccagtggg
cagagtatcccagtggcggtcaagtccctccgtgtgggtcccgagggtccgatgggcaca
gaactgggcgacttcctgcgggaagtatctgtcatgatgaagctagagcacccacacgtg
ctgcgcctgcatggcctcgtactgggccagcctctacagatggtgatggaacttgcgcca
ctgggctccctgcatgcgcgcctgactgccccagcaccgacacccccactgcctgtggcc
ctgctgtgcctttttctgcgtcagttggcaggagccatggcgtacttggggtcctgtggg
ttagtgcaccgggatctcgccacccgcaacctgctgctggcctcacctcgaatgatcaag
gtggcggattttggactggttcggccactgggaggcgcccggggacgctacgtcatgggc
gggccccgtcctatcccctatgcctggtgtgccccagagagcctacgccagggagccttc
tcgtctgcctctgatgtgtggatgtttggcgtgacactctgggaaatgttttctggaggt
gaggaaccctgggcaggtgtcccaccatatctcatcctacagcgactggagaaggaccga
gccaggctgccaaagcctcccctgtgttccagggccctctactccctcgccttgcgctgc
tgggccccacaccctgcagaccggcctagcttttccaacctggaagggctgcttcaagag
gcttggctttctgagggacgctgtgtgagggaggtcacagagccaggtgctttgcggatg
gaacccggtgaccccatcactatcattgagggcagcctggacactgcaacctggaaaggc
cagaatggccggaccctcaaagtgggcaactttccggcttccgcagtgacactagcagac
ttggggggttcaccagtcacccatccagcccacagaggttcccctgcccatggagagaaa
tgcagagggggcacagatggggacagagagaaggcaacgttacaagacctacccccagca
cggagccacagaacgaagatgcccctgcagaggatgcgaggcatttccaagagtctggaa
tcagttctgtccctgggccctagacccacaggaggtggttcaagtcctccagaacttcgg
cgtacaagagctatgccgcaaagactcccagacctacctccacgcccaccagacctgcct
ccacgcccacctattatctgcaactcttctcagcccacccagccccacaaagcccggccc
aaaagagaatcctcacataatcaccgcactggagcacctggagccagcaaagccactgtc
ccctctggaggtcccttgtcagaccccgagtggcagaggaaggttgtagaggtagagctg
agtgtgcatggtgtcacctaccaggagtgccaagtggcactcagaaccactgggggagat
gtggcttctgctatccggaacctcaaggtagaccagctcttccaccttagtaaccggtcc
cgagcagactgtcgtcgcatcctggagcatcaccagtgggacctgtcagcagccagtcgc
tacatcctagcccggtcctga

DBGET integrated database retrieval system