KEGG   Mus musculus (mouse): 83814
Entry
83814             CDS       T01002                                 

Gene name
Nedd4l, 1300012C07Rik, Nedd4, Nedd4-, Nedd4-2, Nedd4b
Definition
(RefSeq) neural precursor cell expressed, developmentally down-regulated gene 4-like
  KO
K13305  E3 ubiquitin-protein ligase NEDD4-like [EC:2.3.2.26]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
mmu04530  Tight junction
mmu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    83814 (Nedd4l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    83814 (Nedd4l)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    83814 (Nedd4l)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    83814 (Nedd4l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    83814 (Nedd4l)
   04121 Ubiquitin system [BR:mmu04121]
    83814 (Nedd4l)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     83814 (Nedd4l)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    83814 (Nedd4l)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   83814 (Nedd4l)
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 83814
NCBI-ProteinID: NP_001107858
MGI: 1933754
Ensembl: ENSMUSG00000024589
UniProt: A0A494BAG2
Structure
PDB: 
1WR7 1WR3 1WR4

Position
18; 18 E1
AA seq 976 aa
MATGLGEPVYGLSEEEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELAL
VQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDP
TMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSEQRDDMEHGWEVVDSN
DSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSLMDVSSESDNNIRQI
NQEAAHRRFRSRRHISEDLEPEASEGGGEGPEPWETISEEMNMAGDSLSLALPPPPASPV
SRTSPQELSEEVSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDTVAEQAHLPPPSTP
TRRARSSTVTGGEESTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQ
LAEDGASGSATNSNNHLVEPQIRRPRSLSSPTVTLSAPLEGAKDSPIRRAVKDTLSNPQS
PQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK
ASLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQ
KYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLD
YGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGL
AVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDE
ENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDL
IKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLL
QFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLRE
KLLMAVENAQGFEGVD
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggcgaccgggcttggggagcctgtctacggactttcggaagaggagggagaatcccgt
atcctcagagtaaaagttgtttctggaattgacctcgccaagaaggacatatttggagcc
agcgacccatacgtgaagctgtccttgtatgtagctgatgagaatagagaacttgctctg
gttcaaaccaagacaattaaaaagacgctgaacccaaagtggaatgaagagttttatttt
agggtaaatccatctaatcacaggctcctatttgaagtatttgacgagaacagattgaca
cgagacgacttcctgggccaggtggacgtgcctcttagtcaccttccgacagaagatcca
accatggagagaccctatacatttaaggattttctcctgcgacctagaagtcataaatct
cgagtcaaggggtttttgaggttgaaaatggcctacatgccgaaaaacggaggtcaggat
gaagaaaacagcgagcagagggatgacatggagcatggatgggaagtggttgactccaac
gactcagcttcccagcaccaggaggagctcccccctcctcccctgccgccaggatgggaa
gagaaagtggacaatttaggccgaacttactatgtcaaccacaacaacaggagtactcag
tggcaccgacccagcttgatggatgtgtcctcggaatcagacaataacatcaggcagatc
aaccaggaggctgcacaccgacgcttccgctctcggaggcacattagtgaagatttggag
cctgaggcctctgaaggcggtggagaaggccctgagccttgggagaccatttcagaggaa
atgaacatggcaggagattctctcagcctggctctgcccccaccgcctgcctccccagtg
tcccggaccagcccccaggagctgtcggaagaagtgagccgaaggttgcagatcactccg
gactccaacggggaacagttcagttctctgattcagagagagccctcgtcaaggcttcgg
tcctgcagtgttaccgacacggttgctgagcaagctcaccttccaccgcccagcacccca
actaggcgagcccgttcgtcaactgtcacgggtggtgaggaatccacgccatcagtggcc
tatgtacataccacgccgggcctgccttcaggctgggaagaaagaaaggatgcaaaggga
cgcacatactatgtcaatcataacaatcgaaccacaacttggactcggccaatcatgcag
cttgcagaagacggtgcctccggatcagccacaaacagtaacaaccacctagtcgaaccc
cagatccgccggccccgtagcctcagctcgccaacagtaactttatctgccccactggag
ggtgccaaggattcacccatccgccgtgccgtgaaagataccctttccaatccacagtcc
cctcagccatcaccttacaactcccccaaaccacaacacaaagtcacacagagcttcctg
ccaccaggctgggagatgaggatagcccccaacggccgacccttcttcattgaccataac
acaaagactacaacctgggaagatccacggttgaaatttccagtacacatgcggtcaaaa
gcatctttaaaccccaatgacctgggccctcttcctcctggctgggaagagaggatccac
ttggatggccgcacgttttacattgaccataatagtaaaattacccagtgggaagatcca
agactacagaacccagccatcactggtccggctgttccgtactccagagagtttaagcag
aaatacgactactttaggaagaaattaaagaagcctgctgatattccaaacaggtttgaa
atgaaacttcacagaaacaacatatttgaagagtcctatcggaggatcatgtctgtaaag
agacctgacgtcctaaaggctaggctgtggattgagtttgaatcagagaaaggcctggac
tatgggggcgtggccagagaatggttcttcttactgtccaaagagatgtttaacccctac
tatggcctcttcgagtactctgccacggacaactacacacttcagatcaatcccaactca
ggcctctgtaatgaagaccatttgtcctatttcaccttcattggaagagttgctggccta
gcggtgtttcatgggaaactcttagatggattcttcattcgaccattctacaagatgatg
ctggggaagcagataacgctgaacgacatggagtccgtggacagcgagtactacaactct
ttgaagtggatcttagaaaacgaccccacggaacttgacctcatgttctgcatagacgaa
gagaactttgggcagacataccaagtggatctgaagcccaacgggtcagaaataatggta
accaatgagaacaaacgagaatacattgacttagtcatccagtggagatttgtgaacagg
gtccagaagcaaatgaatgccttcttggagggatttacagaacttcttccaatcgacttg
attaaaatttttgatgaaaatgagctggagttgctgatgtgcggccttggtgatgtcgac
gtgaacgactggagacagcactctatttacaagaacggctactgccccaaccaccctgtc
atccagtggttctggaaggccgtgctcctgatggatgctgagaagcgcatccggttacta
cagtttgtcacaggcacctccagagtacccatgaatggatttgccgaactctatggttcc
aatggtcctcagctgtttacaatagagcaatggggcagtcccgaaaaactacccagagct
catacatgctttaatcgccttgatttacctccatatgaaacctttgaagatttacgggag
aaacttctcatggctgtggaaaacgctcaaggcttcgaaggtgtggattaa

DBGET integrated database retrieval system