KEGG   Mus musculus (mouse): 83961
Entry
83961             CDS       T01002                                 

Gene name
Nrg4, AI552600
Definition
(RefSeq) neuregulin 4
  KO
K05458  neuregulin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    83961 (Nrg4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    83961 (Nrg4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    83961 (Nrg4)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   83961 (Nrg4)
SSDB
Motif
Pfam: EGF EGF_2 Laminin_EGF
Other DBs
NCBI-GeneID: 83961
NCBI-ProteinID: NP_114391
MGI: 1933833
Ensembl: ENSMUSG00000032311
Vega: OTTMUSG00000024543
UniProt: Q9WTX4
Position
9; 9 B
AA seq 115 aa
MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIPSESN
LSAAFVVLAVLLTLTIAALCFLCRKGHLQRASSVQCEISLVETNNTRTRHSHREH
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccaacagatcacgagcagccctgtggtcccaggcacaggtcattttgcctcaatggg
gggatttgttatgtgatccctactatccccagcccattctgtaggtgcattgaaaattac
accggagcacgctgcgaagaggtttttctcccaagctccagcatcccaagcgaaagtaat
ctgtcggcagctttcgtggtgctggcggtcctcctcactcttaccatcgcggcgctctgc
ttcctgtgcaggaagggccaccttcagagggccagttcagtccagtgtgagatcagcctg
gtagagacaaacaataccagaacccgtcacagccacagagaacactga

DBGET integrated database retrieval system