KEGG   Mus musculus (mouse): 83964
Entry
83964             CDS       T01002                                 

Gene name
Jam3, 1110002N23Rik, JAM-, JAM-3, JAM-C, Jcam, Jcam3
Definition
(RefSeq) junction adhesion molecule 3
  KO
K06785  junctional adhesion molecule 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    83964 (Jam3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    83964 (Jam3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    83964 (Jam3)
SSDB
Motif
Pfam: Ig_3 I-set ig V-set Ig_2 C2-set_2 Izumo-Ig Ig_6 Protocadherin
Other DBs
NCBI-GeneID: 83964
NCBI-ProteinID: NP_075766
MGI: 1933825
Ensembl: ENSMUSG00000031990
Vega: OTTMUSG00000036713
UniProt: Q9D8B7
Position
9; 9 A4
AA seq 310 aa
MALSRRLRLRLYARLPDFFLLLLFRGCMIEAVNLKSSNRNPVVHEFESVELSCIITDSQT
SDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVAL
NDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPL
PTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDL
NIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGESYKSPGKHDGVNYIRTSEEG
DFRHKSSFVI
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcgctgagccggcggctgcgacttcgactgtacgcgcggctgcctgacttcttcctg
ctgctgctcttcaggggctgcatgatagaggcagtgaatctcaaatccagcaaccgaaac
ccagtggtacatgaatttgaaagtgtggaattgtcttgcatcattacggactcacagaca
agtgaccctaggattgaatggaagaaaatccaagatggccaaaccacatatgtgtatttt
gacaacaagattcaaggagacctggcaggtcgcacagatgtgtttggaaaaacttccctg
aggatctggaatgtgacacgatcggattcagccatctatcgctgtgaggtcgttgctcta
aatgaccgaaaagaagttgatgagattaccattgagttaattgtgcaagtgaagccagtg
acccctgtctgcagaattccagccgctgtacctgtaggcaagacggcaacactgcagtgc
caagagagcgagggctatccccggcctcactacagctggtaccgcaatgatgtgccactg
cctacagattccagagccaatcccaggttccagaattcctctttccatgtgaactcggag
acaggcactctggttttcaatgctgtccacaaggacgactctgggcagtactactgcatt
gcttccaatgacgcaggtgcagccaggtgtgaggggcaggacatggaagtctatgatttg
aacattgctgggattattgggggagtccttgttgtccttattgttcttgctgtgattacg
atgggcatctgctgtgcgtacagacgaggctgcttcatcagcagtaaacaagatggagaa
agctataagagcccagggaagcatgacggtgttaactacatccggacgagtgaggagggt
gacttcagacacaaatcgtcctttgttatctga

DBGET integrated database retrieval system