KEGG   Mus musculus (mouse): 83984
Entry
83984             CDS       T01002                                 

Gene name
Tssk6, Sstk, TSK-6, TSSK-6
Definition
(RefSeq) testis-specific serine kinase 6
  KO
K08811  testis-specific serine kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    83984 (Tssk6)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    83984 (Tssk6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83984 (Tssk6)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  TSSK family
   83984 (Tssk6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    83984 (Tssk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH RIO1 YrbL-PhoP_reg Pkinase_fungal Choline_kinase TBK1_ULD
Other DBs
NCBI-GeneID: 83984
NCBI-ProteinID: NP_114393
MGI: 2148775
Ensembl: ENSMUSG00000047654
Vega: OTTMUSG00000050077
UniProt: Q925K9
Position
8; 8 B3.3
AA seq 273 aa
MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRE
LSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGSQARELFSQIA
GAVRYLHDHHLVHRDLKCENVLLSPDERRVKITDFGFGRQAHGYPDLSTTYCGSAAYASP
EVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDGLELSERC
KSLIAELLQFSPSARPSAGQVARNGWLRAGDSG
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtcgggcgacaaactcctgagcgaacttggctataagctgggccgcacgataggtgag
ggcagctactccaaggtgaaagtggccacctccaagaagtataaagggacggtggccatc
aaggtggtggaccgccggcgagcgcctccggacttcgtcaacaagttcctgcctcgagag
ctgtccatcctgcggggagtacggcacccgcacatcgtacacgttttcgagttcatcgaa
gtgtgcaatgggaagctgtacatcgtgatggaggcagcagccaccgacctgctgcaggca
gtgcagcgcaacgggcgcatcccggggtcgcaggcgcgcgaactcttctcgcagatcgcg
ggcgccgtgcgctacctgcacgaccaccacctggtgcaccgcgacctcaagtgcgaaaac
gtgctgctaagccctgacgagcgccgcgtcaagatcacggatttcggtttcggccgccag
gcgcacggctacccagacctgagcaccacctactgcggctcggccgcgtatgcgtcacct
gaggtgctcctgggcatcccctacgaccctaagaaatacgacgtgtggagcctgggcgtt
gtgctctacgtcatggtcaccgggtgcatgcccttcgacgactcggacattgctggccta
ccccggcgccagaagcgcggcgtgctctaccctgacggcctcgaactgtcggaacgatgc
aaatccttgatcgccgagctgctacagttcagcccgtctgcccggccctcggcgggccag
gtggcgcgcaatggctggctgcgggccggggactccggctag

DBGET integrated database retrieval system