KEGG   Mus musculus (mouse): 84004
Entry
84004             CDS       T01002                                 

Symbol
Mcam, 1-gicerin, AV025631, CD146, CD149, Muc18, s-endo, s-gicerin
Name
(RefSeq) melanoma cell adhesion molecule
  KO
K06534  melanoma cell adhesion molecule
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    84004 (Mcam)
   04515 Cell adhesion molecules [BR:mmu04515]
    84004 (Mcam)
   04090 CD molecules [BR:mmu04090]
    84004 (Mcam)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   84004 (Mcam)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  MCAM
   84004 (Mcam)
CD molecules [BR:mmu04090]
 Proteins
  84004 (Mcam)
SSDB
Motif
Pfam: Ig_3 ig Ig_2 C2-set_2 I-set V-set Ig_4 Insulin_TMD CD34_antigen DUF4198
Other DBs
NCBI-GeneID: 84004
NCBI-ProteinID: NP_075548
MGI: 1933966
Ensembl: ENSMUSG00000032135
Vega: OTTMUSG00000016731
UniProt: Q8R2Y2
Position
9:44045946..44054024
AA seq 648 aa
MGLPKLVCVFLFAACCCCRRAAGVPGEEKQPVPTPDLVEAEVGSTALLKCGPSRASGNFS
QVDWFLIHKERQILIFRVHQGKGQREPGEYEHRLSLQDSVATLALSHVTPHDERMFLCKS
KRPRLQDHYVELQVFKAPEEPTIQANVVGIHVDRQELREVATCVGRNGYPIPQVLWYKNS
LPLQEEENRVHIQSSQIVESSGLYTLKSVLSARLVKEDKDAQFYCELSYRLPSGNHMKES
KEVTVPVFYPAEKVWVEVEPVGLLKEGDHVTIRCLTDGNPQPHFTINKKDPSTGEMEEES
TDENGLLSLEPAEKHHSGLYQCQSLDLETTITLSSDPLELLVNYVSDVQVNPTAPEVQEG
ESLTLTCEAESNQDLEFEWLRDKTGQLLGKGPVLQLNNVRREAGGRYLCMASVPRVPGLN
RTQLVSVGIFGSPWMALKERKVWVQENAVLNLSCEASGHPQPTISWNVNGSATEWNPDPQ
TVVSTLNVLVTPELLETGAECTASNSLGSNTTTIVLKLVTLTTLIPDSSQTTGLSTLTVS
PHTRANSTSTEKKLPQPESKGVVIVAVIVCTLVLAVLGAALYFFYKKGKLPCGRSGKQEI
TLPPTRKSEFVVEVKSDKLPEEMALLQGSNGDKRAPGDQGEKYIDLRH
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggggctgcccaaactggtgtgcgtcttcttgttcgctgcctgctgctgctgtcgccgt
gccgcgggtgtgccaggagaggaaaagcagccagtacccacgcccgacctggtggaggca
gaagtgggcagcacagcccttctcaagtgtggcccctcacgggcctcaggcaacttcagc
caagtggactggtttttgattcacaaggagaggcagatactgattttccgtgtgcaccaa
ggcaagggccagcgggaacctggtgaatatgagcaccgccttagcctccaagactcggtg
gctactctggccctgagtcacgtcactccccatgatgagcgaatgttcctgtgtaagagc
aagcgaccacggctccaggatcactacgttgagcttcaggtcttcaaagccccagaggaa
ccaactattcaagccaatgtcgtgggcatccatgtggacaggcaagagctcagggaggtt
gctacctgtgtggggagaaacggctaccccattcctcaagtcctatggtacaagaacagt
ctgcccttgcaagaggaggagaaccgagttcatatccagtcatcacagattgtcgagtcc
agtggcttgtacaccttgaagagtgttctgagtgcacgcctagttaaggaagacaaagat
gcccagttttactgtgaactcagctaccggctacccagtgggaaccacatgaaggaatct
aaggaggtcactgtccctgttttctaccctgcagaaaaagtgtgggtggaggtagagcct
gtggggctgctgaaggaaggggatcatgtgacaatcaggtgtctgacagatggcaaccct
caaccccacttcactatcaacaagaaggaccccagcactggggagatggaagaggagagc
accgatgaaaatgggctcctgtccttggagcctgccgaaaagcaccatagcgggctctac
cagtgtcagagtctggacctggaaactaccatcacactgtcaagtgaccccctggagctg
ctggtgaactatgtgtctgatgttcaagtgaatccaactgcccctgaagtccaggaaggt
gagagcctcacgctgacctgcgaggcagaaagtaaccaggaccttgagtttgagtggctg
agagacaagacaggccagctgctgggaaagggtcccgtcctccagctaaacaacgtgaga
cgggaagcagggggacggtatctctgcatggcatctgtccccagagttcctggcttgaat
cgtacccagctggtcagcgtgggcatttttgggtccccatggatggcattaaaggagagg
aaggtgtgggtgcaagagaatgcagtgctgaatctgtcttgtgaggcttcaggacatcct
cagcccaccatctcctggaatgtcaatggttcggcaactgaatggaacccagatccacag
acagtagtgagcaccttgaatgtccttgtgacgccagagcttctggagacaggtgcagag
tgtacagcctccaactccctgggctcaaacaccaccaccattgttctgaagctggtcact
ttaaccaccctcatacctgactccagccaaaccactggcctcagcaccctcacagtcagt
cctcacaccagagccaacagcacctccacagagaaaaagctgccacagccagagagcaaa
ggtgtggtcatcgtggctgtgatagtgtgtaccttggtgcttgctgtgctgggtgctgct
ctctatttcttctacaagaagggcaagctgccatgtggacgctcgggaaaacaggagatc
acgctgcccccgactcgtaagagtgaatttgtagttgaagttaagtcagataagctccca
gaagagatggctctccttcagggcagcaacggtgacaagagggctccaggagaccaggga
gagaaatacatcgatctgaggcattag

DBGET integrated database retrieval system