KEGG   Mus musculus (mouse): 84112Help
Entry
84112             CDS       T01002                                 

Gene name
Sucnr1, Gpr91
Definition
(RefSeq) succinate receptor 1
  KO
K10042  succinate receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    84112 (Sucnr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    84112 (Sucnr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    84112 (Sucnr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 84112
NCBI-ProteinID: NP_115776
MGI: 1934135
Ensembl: ENSMUSG00000027762
Vega: OTTMUSG00000051954
UniProt: Q99MT6
Position
3; 3 D
AA seq 317 aa AA seqDB search
MAQNLSCENWLATEAILNKYYLSAFYAIEFIFGLLGNVTVVFGYLFCMKNWNSSNVYLFN
LSISDFAFLCTLPILIKSYANDKGTYGDVLCISNRYVLHTNLYTSILFLTFISMDRYLLM
KYPFREHFLQKKEFAILISLAVWALVTLEVLPMLTFINSVPKEEGSNCIDYASSGNPEHN
LIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKRRSQQQATALPLDKPQRLVVLAVVIFSIL
FTPYHIMRNLRIASRLDSWPQGCTQKAIKSIYTLTRPLAFLNSAINPIFYFLMGDHYREM
LISKFRQYFKSLTSFRT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaatttatcttgtgagaattggttggcaacagaggctatcttgaataagtac
tacctctctgcattttatgcaatcgagttcatttttggactgcttgggaatgtcactgtg
gtgtttggctacctcttctgcatgaagaactggaacagcagcaatgtctatctttttaac
ctttccatctctgactttgctttcctgtgcacccttcccatcctgataaagagttatgcc
aatgataaggggacctatggagatgttctctgtataagcaaccgatatgtgcttcacacc
aacctctacaccagcatcctcttcctcactttcattagcatggaccgatatctgctcatg
aagtaccctttccgagaacactttctacaaaagaaggaatttgccattttaatctcgctg
gctgtctgggccttagtgaccttagaagttctacccatgctcactttcatcaattctgtc
ccaaaagaagagggcagtaactgcatcgactatgcaagttctggaaaccctgaacacaat
ctcatttacagcctctgcctgactttgttgggcttcctaattcctctctctgtgatgtgc
ttcttctactacaagatggtagtcttcttaaagaggaggagccagcagcaagcaactgcc
ctgccactggacaaaccccaacgcctggtggtcctggcagttgtgatcttctctatactc
ttcacaccctatcatatcatgcgcaatttgaggatcgcctcacgcctggatagttggcca
caaggatgtacacagaaggccatcaaatctatatacacactgacacggcctctggccttt
ctgaacagtgccatcaatcccatcttctacttcctcatgggagaccattacagagagatg
ctgattagtaagttcagacaatacttcaagtcccttacatccttcaggacatga

DBGET integrated database retrieval system