KEGG   Mus musculus (house mouse): 84652
Entry
84652             CDS       T01002                                 
Symbol
Fam126a, AB030242, Drctnnb1a
Name
(RefSeq) family with sequence similarity 126, member A
  KO
K21844  protein FAM126
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    84652 (Fam126a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    84652 (Fam126a)
SSDB
Motif
Pfam: Hyccin
Other DBs
NCBI-GeneID: 84652
NCBI-ProteinID: NP_444320
MGI: 2149839
Ensembl: ENSMUSG00000028995
UniProt: Q6P9N1
Position
5:complement(24120274..24235723)
AA seq 521 aa
MFTSEIGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVTSLYKVIQEPQSELLEPVCHQL
FEFYRSGEEQLLRFTLQFLPELMWCYLAVSASRDVHSSGCIEALLLGVYNLEIVDKHGHS
KVLSFTIPSLSKPSVYHEPSSIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEV
LTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYRGVSSRIPISSGFMVQM
LTGVYFAIYNGEWDLAQKALDDIIYRAQLELYPEPLLVANAIKASLPHGAMKSSKEGTRC
IQVEITPTSSRISRNAVTSMSIRGHRWKRHGDTELTGQEELMDITEVDEGFYSRAASSTS
QSGLSNSSHNCSNKTSVGKNQRRSGGSKAGAKERETAGESCRDHFARKQTQRAQSENLEL
LSLKRLTLTSSQSLPKPSSQGLAKTAATVFSKSFEQVSGAPVPRSPSPAIGCVAGADANR
FSACSLQEEKLIYVSERTELAVKCQAGQQGPPSISVTLSAE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgttcacctcagagataggagttgtggaagaatggctgtcagaatttaagacactccca
gaaacatctttgccaaattatgccacaaatttgaaagacaagagttctttagttacatct
ctctataaagttatccaggagccacagagtgagttactagagcccgtgtgtcaccagctc
tttgagttctaccgcagtggggaggagcagctgctgcgcttcactctgcagttcctcccg
gagctgatgtggtgctacctcgccgtgtcggccagcagagatgtgcacagcagcggctgc
attgaggctctcctgctgggggtttacaacctggaaatagttgacaaacacggacatagt
aaagtattgagttttacaattccatctttatccaaaccatctgtatatcatgaaccttcc
agcattgggtctatggcgctgacggagagtgcgctgtcccagcatggcttatcaaaagtc
gtgtacagtggaccccatcctcaacgggagatgctgacagcacagaacaggtttgaagta
ttgacattccttctgctgtgttacaatgctgccttaacctacatgcccagtgtctctctt
cagtcactgtgtcagatttgttcaagaatatgtgtctgtggctatccccgacaacatgta
agaaaatacagaggtgtgagcagcaggataccgatttcatccggcttcatggtgcagatg
ctaacaggagtgtattttgccatatacaatggagaatgggatctagctcagaaagcactg
gatgacattatatacagagcccagctagaattgtatccagagcctctgctggttgctaat
gcaataaaggcttcattgcctcatggtgccatgaaatctagtaaggaaggtacaaggtgt
attcaagtggagatcacaccaacctcctctagaatatcaagaaatgcagttaccagcatg
tcaatacgaggtcacaggtggaaaagacatggagatacagaattaacaggtcaagaagaa
ctgatggacataactgaagttgacgagggattttattccagggctgcgtctagcaccagc
cagtcgggtctatcaaacagtagtcacaattgtagtaacaagacaagtgtaggaaagaac
cagagacggtcgggaggaagcaaagctggagcgaaggagagagaaactgcaggggagtct
tgcagagatcactttgctcgcaagcaaacccagagagcccagagcgagaaccttgagctt
ctctctctgaagagactgaccttaacctccagccagtccctgcccaagcccagcagccaa
ggcctggctaagactgcggccactgtatttagtaaatcctttgaacaagtcagtggtgcc
ccagtcccacgtagcccttctcccgccattggctgtgttgctggagcagatgccaataga
ttttctgcctgtagtctccaagaagaaaagcttatttatgtgtcagaaaggactgaactt
gcagtgaagtgtcaagccggccagcagggacctcctagtattagcgtcactctgtctgca
gagtaa

DBGET integrated database retrieval system