KEGG   Mus musculus (mouse): 85305
Entry
85305             CDS       T01002                                 

Symbol
Kars, AA589550, AL024334, AL033315, AL033367, D8Ertd698, D8Ertd698e, D8Wsu108, D8Wsu108e, Kars1, L, LysRS, mKIAA0070
Name
(RefSeq) lysyl-tRNA synthetase
  KO
K04567  lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    85305 (Kars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    85305 (Kars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    85305 (Kars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     85305 (Kars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   85305 (Kars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    85305 (Kars)
 Prokaryotic type
   Other AARSs
    85305 (Kars)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Other DBs
NCBI-GeneID: 85305
NCBI-ProteinID: NP_444322
MGI: 1934754
Ensembl: ENSMUSG00000031948
Vega: OTTMUSG00000061807
UniProt: Q99MN1 Q3TIV6
Position
8 E1; 8 58.27 cM
AA seq 595 aa
MATLQESEVKVDGEQKLSKNELKRRLKAEKKLAEKEAKQKELSEKQLNQTASAPNHTADN
GVGAEEETLDPNQYYKIRSQAVQQLKVTGEDPYPHKFHVDISLTQFIQEYSHLQPGDHLT
DVTLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFVHINNKLRRGDII
GVEGNPGKTKKGELSIIPQEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQ
KFIVRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPEL
YHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMLSGMV
KSITGSYKITYHPDGPEGQAYEVDFTPPFRRISMVEELEKALGVKLPETSLFETEETRKI
LDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCISPTFICDHPQIMSPLAKWHRSKEGL
TERFELFVMKKEICNAYTELNDPVRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLP
PTAGWGMGIDRLTMFLTDSNNIKEVLLFPAMKPEDKKETAATTETPESTEASPSV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggccacgctgcaggagagtgaagtcaaagtggatggcgagcagaaactaagcaagaat
gagctgaagaggcgtctgaaagctgagaagaaactggcagagaaggaggccaagcagaaa
gagctgagtgagaaacagctaaaccagactgcttccgctcccaaccacacggctgacaat
ggcgtgggtgctgaggaggagactctggacccaaatcaatactacaagatccgaagtcaa
gccgtccagcagctgaaggtcactggggaggatccgtacccacacaagttccacgtggac
atctcactcactcagttcatccaagaatatagtcacctgcagcctggggaccacctgact
gatgtcaccctcaaagtggcaggccgcatccacgccaagagggcctctggagggaagctc
atcttctatgacctgcgaggagagggggtcaagttacaagtcatggccaactccaggaat
tacaaatcagaggaggaatttgttcatatcaataacaaactgcgccggggagacataatt
ggagttgagggcaatcccgggaaaaccaagaagggcgagctgagcatcatcccccaggag
atcacgctgctgtccccctgcttgcacatgctgcctcatcttcactttggcctcaaagac
aaggaaacacggtatcgtcaaagatacttggacttgatcctgaacgactttgtgaggcag
aaatttatcgtccgctctaagatcatcacatacataagaagtttcttggatgagctgggc
ttcctagagatcgaaactcccatgatgaacatcattcccgggggagctgtggccaagcct
ttcatcacctatcacaatgagctggacatgaacttgtatatgagaattgctccagaactc
taccacaagatgctggtggttggtggcattgaccgggtttatgaaattgggcgccagttc
cggaacgaagggattgatttgactcacaatcctgagttcaccacctgtgagttctacatg
gcctatgcagactatcatgacctcatggagatcacagagaagatgctgtcagggatggtg
aagagcattacaggcagttacaagatcacctaccacccagatgggccggaaggccaagcc
tacgaggtcgacttcaccccacccttccgaagaatcagcatggtagaagagcttgagaaa
gccctaggtgtgaagctgccagaaaccagtctctttgaaactgaagaaactcggaaaatt
cttgatgatatttgtgttgcaaaagctgttgaatgccccccacctcggaccacagccagg
ctccttgataagctcgttggcgagttcctcgaagtcacatgcatcagccctaccttcatc
tgtgatcacccacagatcatgagtcctttggccaaatggcaccgctccaaagagggtctc
acggagcgctttgagctgtttgtcatgaagaaggagatatgcaatgcctatactgagctg
aatgaccccgtgcggcagaggcagctgtttgaggagcaggccaaggccaaggctgccggt
gatgacgaggccatgttcatagacgagaacttctgtactgccctggaatacgggctgcct
cccacagcgggctggggcatgggcattgatcggctcaccatgtttctcaccgattccaac
aatatcaaggaagtacttctgtttcctgccatgaagccagaggacaagaaggaaactgca
gcgaccactgaaaccccagagagcacagaggccagcccctctgtctag

DBGET integrated database retrieval system