KEGG   Mus musculus (mouse): 93671
Entry
93671             CDS       T01002                                 

Symbol
Cd163, CD163v2, CD163v3
Name
(RefSeq) CD163 antigen
  KO
K06545  CD163 antigen
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    93671 (Cd163)
CD molecules [BR:mmu04090]
 Proteins
  93671 (Cd163)
SSDB
Motif
Pfam: SRCR SRCR_2 Hepsin-SRCR
Other DBs
NCBI-GeneID: 93671
NCBI-ProteinID: NP_444324
MGI: 2135946
Ensembl: ENSMUSG00000008845
Vega: OTTMUSG00000056662
UniProt: Q2VLH6
Position
6; 6 F2
AA seq 1121 aa
MGGHRMVLLGGAGSPGCKRFVHLGFFVVAVSSLLSASAVTNAPGEMKKELRLAGGENNCS
GRVELKIHDKWGTVCSNGWSMNEVSVVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCT
GNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWG
TVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHR
GWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDAS
VVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDA
GVTCSDGADLELRLVGGGSRCAGIVEVEIQKLTGKMCSRGWTLADADVVCRQLGCGSALQ
TQAKIYSKTGATNTWLFPGSCNGNETTFWQCKNWQWGGLSCDNFEEAKVTCSGHREPRLV
GGEIPCSGRVEVKHGDVWGSVCDFDLSLEAASVVCRELQCGTVVSILGGAHFGEGSGQIW
GEEFQCSGDESHLSLCSVAPPLDRTCTHSRDVSVVCSRYIDIRLAGGESSCEGRVELKTL
GAWGPLCSSHWDMEDAHVLCQQLKCGVAQSIPEGAHFGKGAGQVWSHMFHCTGTEEHIGD
CLMTALGAPTCSEGQVASVICSGNQSQTLLPCSSLSPVQTTSSTIPKESEVPCIASGQLR
LVGGGGRCAGRVEVYHEGSWGTVCDDNWDMTDANVVCKQLDCGVAINATGSAYFGEGAGA
IWLDEVICTGKESHIWQCHSHGWGRHNCRHKEDAGVICSEFMSLRLTNEAHKENCTGRLE
VFYNGTWGSIGSSNMSPTTVGVVCRQLGCADNGTVKPIPSDKTPSRPMWVDRVQCPKGVD
TLWQCPSSPWKQRQASPSSQESWIICDNKIRLQEGHTDCSGRVEIWHKGSWGTVCDDSWD
LNDAKVVCKQLGCGQAVKALKEAAFGPGTGPIWLNEIKCRGNESSLWDCPAKPWSHSDCG
HKEDASIQCLPKMTSESHHGTGHPTLTALLVCGAILLVLLIVFLLWTLKRRQIQRLTVSS
RGEVLIHQVQYQEMDSKADDLDLLKSSGVIQRHTEKENDNL
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgggtggacacagaatggttcttcttggaggtgctggatctcctggttgtaaaaggttt
gtccatctaggtttctttgttgtggctgtgagctcacttctcagtgcctctgctgtcact
aacgctcctggagaaatgaagaaggaactgagactggcgggtggtgaaaacaactgtagt
gggagagtggaacttaagatccatgacaagtggggcacagtgtgcagtaacggctggagc
atgaatgaagtgtccgtggtttgccagcagctgggatgcccaacttctattaaagccctt
ggatgggctaactccagcgccggctctggatatatctggatggacaaagtttcttgtaca
gggaatgagtcagctctttgggactgcaaacatgatgggtggggaaagcataactgtacc
catgaaaaagatgctggagtgacctgctcagatggatctaatttggagatgagactggtg
aacagtgcgggccaccgatgcttaggaagagtagaaataaagttccagggaaagtggggg
acggtgtgtgacgacaacttcagcaaagatcacgcttctgtgatttgtaaacagcttgga
tgtggaagtgccattagtttctctggctcagctaaattgggagctggttctggaccaatc
tggctcgatgacctggcatgcaatggaaatgagtcagctctctgggactgcaaacaccgg
ggatggggcaagcataactgtgaccatgctgaggatgtcggtgtgatttgcttagaggga
gcagatctgagcctgagactagtggatggagtgtccagatgttcaggaagattggaagtg
agattccaaggagaatgggggaccgtgtgtgatgataactgggatctccgggatgcttct
gtggtgtgcaagcaactgggatgtccaactgccatcagtgccattggtcgagttaatgcc
agtgagggatctggacagatttggcttgacaacatttcatgcgaaggacatgaggcaact
ctttgggagtgtaaacaccaagagtggggaaagcattactgtcatcatagagaagacgct
ggtgtgacatgttctgatggagcagatctggaacttagacttgtaggtggaggcagtcgc
tgtgctggcattgtggaggtggagattcagaagctgactgggaagatgtgtagccgaggc
tggacactggcagatgcggatgtggtttgcagacagcttggatgtggatctgcgcttcaa
acccaggctaagatctactctaaaactggggcaacaaatacgtggctctttcctggatct
tgtaatggaaatgaaactactttttggcaatgcaaaaactggcagtggggcggcctttcc
tgtgataatttcgaagaagccaaagttacctgctcaggccacagggaacccagactggtt
ggaggagaaatcccatgctctggtcgtgtggaagtgaaacacggagacgtgtggggctcc
gtctgtgattttgacttgtctctggaagctgccagtgtggtgtgcagggaattacaatgt
ggaacagtcgtctctatcctagggggagcacattttggagaaggaagtggacagatctgg
ggtgaagaattccagtgtagtggggatgagtcccatctttcactatgctcagtggcgccc
ccgctagacagaacttgtacccacagcagggatgtcagcgtagtctgctcacgatacata
gatattcgtctggcaggcggcgagtcctcctgtgagggaagagtggagctcaagacactc
ggagcctggggtcccctctgcagttctcattgggacatggaagatgctcatgtcttatgt
cagcagctgaagtgtggggttgcccaatctattccagaaggagcacattttgggaaagga
gctggtcaggtctggagtcacatgttccactgcactggaactgaggaacatataggagat
tgcctcatgactgctctgggtgcgccgacgtgttccgaaggacaggtggcctctgtcatc
tgctcaggaaaccaatcccagacactattgccatgtagttcattgtctccagtccaaaca
acaagctctacaattccaaaggagagtgaagttccctgcatagcaagtggccagcttcgc
ttggtaggtggaggtggtcgctgcgctggaagagtggaggtctaccacgagggctcttgg
ggcaccgtctgtgatgacaattgggatatgactgatgccaatgtggtgtgcaagcagctg
gactgtggcgtggcaattaacgccactggctctgcttacttcggggaaggagcaggagct
atctggctagacgaagtcatctgcactgggaaagagtctcatatttggcagtgccattca
catggctggggacgccataactgcaggcacaaagaagatgcaggtgttatctgctccgag
ttcatgtctctgaggctgaccaacgaagcccacaaagaaaactgcacaggtcgccttgaa
gtgttttacaatggtacatggggcagtattggcagtagcaatatgtctccaaccactgtg
ggggtggtgtgccgtcagctgggctgtgcagacaacgggactgtgaaacccataccttca
gacaagacaccatccaggcccatgtgggtagatcgtgtgcagtgtccaaaaggagttgac
actttgtggcagtgcccctcgtcaccttggaaacagagacaggccagcccctcctcccag
gagtcctggatcatctgtgacaacaaaataagactccaggaagggcatacagactgttct
ggacgtgtggagatctggcacaaaggttcctggggaacagtgtgtgatgactcctgggat
cttaatgatgctaaggttgtatgtaagcagttgggctgtggccaagctgtgaaggcacta
aaagaagcagcatttggtccaggaactgggcccatatggctcaatgaaattaagtgtaga
gggaatgagtcttccctgtgggattgtcctgccaaaccgtggagtcacagcgactgtggg
cacaaagaagatgcttccatccagtgcctcccaaaaatgacttcagaatcacatcatggc
acaggtcaccccaccctcacggcactcttggtttgtggagccattctattggtcctcctc
attgtcttcctcctgtggactctgaagcgacgacagattcagcgacttacagtttcctca
agaggagaggtcttgatacatcaagttcagtaccaagagatggattcaaaggcggatgat
ctggacttgctgaaatcctcgggggtcattcagaggcacactgagaaggaaaatgataat
ttataa

DBGET integrated database retrieval system