KEGG   Mus musculus (mouse): 93679Help
Entry
93679             CDS       T01002                                 

Gene name
Trim8, AA408830, BB006755, GERP, Rnf27
Definition
(RefSeq) tripartite motif-containing 8
  KO
K12001  tripartite motif-containing protein 8 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    93679 (Trim8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     93679 (Trim8)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    93679 (Trim8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-B_box zf-RING_5 zf-RING_10 zf-Nse dCache_2
Motif
Other DBs
NCBI-GeneID: 93679
NCBI-ProteinID: NP_444330
MGI: 1933302
Ensembl: ENSMUSG00000025034
UniProt: Q99PJ2
Position
19; 19 C3
AA seq 551 aa AA seqDB search
MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYN
QKPGLEKNLKLTNIVEKFNALHVEKPPTALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQ
THLQQPSTARGHLLVEADDVRAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVC
DVEIRRNEIRKMLMKQQERLEEREQDIEDQLYKLESDKRLVEEKVSQLKEEVRLQYEKLH
QLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGSLQRLFDKTEDVGFMK
NTKSVKILMDRTQTCTGSSLSPPKIGHLNSKLFLNEVAKKEKQLRKMLEGPFSTPVPFLQ
SVPLYPCGVNSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASSEGQSGQPLGPCS
STQHLVALPGGTQPVHSSPVFPPSQYPNGSTTQQPMLPQYGGRKILVCSVDNCYCSSVAN
HGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLPGLAVRDWLDASQQPGHQDFYRVY
GQPSTKHYVTS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaattggaagaactgctttgaggaggagctcatctgccccatctgcctgcac
gttttcgtggaaccggtgcagctgccatgcaaacataacttctgccggggctgcatcggc
gaggcttgggccaaggacagtggccttgtgcgctgcccggagtgcaaccaggcctacaat
cagaagccgggcctggagaagaacctgaagctcaccaacatcgtggagaagttcaacgcc
ctgcacgtggagaagccgccgacggcactgcactgcgtgttctgtcgccgcggccccccg
ctgccggcacagaaggtctgcctgcgctgcgaggctccctgctgccagtctcacgtgcag
acgcacctgcagcagccctccaccgcccgcgggcacctcctggtggaggcggacgacgtg
cgggcctggagctgcccgcagcacaacgcctaccgcctgtaccactgcgaggccgagcag
gtggctgtgtgccagtactgctgctactacagcggcgcgcatcagggacactcggtgtgt
gacgtggagatacggaggaatgagatacggaagatgctcatgaagcagcaggagcggctg
gaggagagagagcaggacattgaggaccagctgtacaagctcgagtcagacaagcgcctg
gtggaggagaaagtgagccagctgaaggaggaggtgcggctgcagtacgaaaagctgcac
cagctgctggatgaagacttgcggcagacagtggaggtcctggacaaggcgcaagccaag
ttctgcagcgagaacgcggcgcaggcgctgcaccttggggagcgcatgcaggaggccaag
aagctgctgggctccctgcagcgtctcttcgacaagacagaggacgtcggcttcatgaag
aacaccaagtctgtgaaaatcctaatggacaggacccagacctgcacgggcagcagcctt
tctccccctaagatcggccacctgaactccaagctgttcctgaacgaggtggccaagaag
gagaagcagttgcggaagatgctagaaggtcccttcagcacaccggtgcccttcctacag
agcgtacccctgtacccttgtggtgtgaacagctctggggccgaaaagcgcaagcactcg
acagccttccctgaggctagcttcctggagacttcgtcaggcccagtgggcggccagtac
ggggcagcgggcacagccagcagcgaggggcagtctgggcagcccctgggtccctgcagc
tccacgcagcacttggtggctctgccaggcggtacccagccagtacactcgagtcccgtg
ttccccccttcgcagtaccccaacggctccaccacccagcaacccatgctcccccagtat
ggcggccgcaagattctcgtctgttctgtggacaactgttactgctcttccgtggccaac
cacggtggccaccagccgtacccccgatccggccacttcccctggacagtgccctcacag
gagtattcacacccacttccacccacaccctccgtccctcagtcacttcctggcctggcg
gtcagagactggctcgacgcttctcagcagcctggccaccaggatttctacagggtgtat
gggcagccgtccaccaaacactatgtgacaagctaa

DBGET integrated database retrieval system