KEGG   Mus musculus (mouse): 93683
Entry
93683             CDS       T01002                                 

Gene name
Glce, 1110017N23Rik, AI747411, C130034A12Rik, Hsepi
Definition
(RefSeq) glucuronyl C5-epimerase
  KO
K01793  heparosan-N-sulfate-glucuronate 5-epimerase [EC:5.1.3.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
mmu01100  Metabolic pathways
Module
mmu_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    93683 (Glce)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.17  heparosan-N-sulfate-glucuronate 5-epimerase
     93683 (Glce)
SSDB
Motif
Pfam: C5-epim_C EspG
Other DBs
NCBI-GeneID: 93683
NCBI-ProteinID: NP_201577
MGI: 2136405
Ensembl: ENSMUSG00000032252
Vega: OTTMUSG00000046492
UniProt: Q9EPS3
Position
9; 9 B
AA seq 618 aa
MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRHLSSGFRVDGLEKRSAASE
SNHYANHIAKQQSEEAFPQEQQKAPPVVGGFNSNGGSKVLGLKYEEIDCLINDEHTIKGR
REGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRSPYHPDGVFMSFEGY
NVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAE
DRDRNIRPNEWTVPKGCFMASVADKSRSTNVKQFIAPETSEGVSLQLGNTKDFIISFDLK
LLTNGSVSVVLETTEKNQLFTVHYVSNTQLIAFRDRDIYYGIGPRTSWSTVTRDLVTDLR
KGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEK
GGWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDYVFLSSALRATAPYKF
PSEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGETLGKEARSLYE
RGMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPIFK
EFVKRWKSYLKGSRAKHN
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgcgttgtttggcagctcgggtcaactataagactttgattatcatctgtgcgctattc
actttggtcacagtacttttgtggaataagtgttccagcgacaaagcaatccagtttcct
cggcacttgagtagtggattcagagtggatggattagaaaaaagatcagcagcatctgaa
agtaaccactatgccaaccacatagccaaacagcagtcagaagaggcatttcctcaggaa
caacagaaggcaccccctgttgttgggggcttcaatagcaacgggggaagcaaggtgtta
gggctcaaatatgaagagattgactgtctcataaacgatgagcacaccattaaagggaga
cgagaggggaatgaagttttccttccattcacttgggtagagaaatactttgatgtttat
ggaaaagtggtccagtatgacggctatgatcgatttgaattctctcatagctattccaaa
gtctatgcacagagatcaccttatcaccctgacggtgtgtttatgtcctttgaaggctac
aatgtggaagtccgagacagagtcaaatgtataagtggagttgaaggtgtgccattatct
acccagtgggggcctcaaggctatttctacccaatccagattgcacagtatgggctaagt
cattacagcaagaatctaaccgagaaaccccctcacatagaagtatatgaaacagcagaa
gacagggacagaaacatcagacctaatgaatggactgtgcccaaggggtgcttcatggcc
agtgtggcagacaagtctagatccaccaatgttaaacagtttattgctccagaaaccagt
gaaggtgtgtctttgcagctgggaaacacaaaagacttcattatttcatttgacctcaag
cttttaacaaatgggagtgtgtctgtggttctggagaccacagaaaagaatcagctcttc
actgtgcattatgtctcaaacacccagctgattgctttcagagacagggacatatactac
ggcattgggcccagaacttcatggagtacagttaccagagacctggtcactgacctcagg
aaaggagtgggcctttctaacacaaaagctgtcaagccaaccaaaatcatgcccaaaaag
gtggttaggttgattgcaaaagggaagggattcctggacaacattaccatctcaaccaca
gcccacatggctgcattctttgctgcaagtgactggctagtgaggaaccaggatgagaaa
ggtggctggccaattatggtgacccggaagttaggggaagggtttaaatctttagaacca
ggatggtactctgccatggcacaagggcaagccatctctaccttagtcagggcctatctt
ctaacgaaagactatgtattcctcagttcagctttaagggcaacagccccatacaagttt
ccgtcagagcagcatggagttaaagccgtgttcatgaataaacatgactggtatgaagaa
tatccaaccacacctagctcttttgttttaaatggctttatgtattctttaattgggctg
tatgacctaaaagaaacagcaggggagacacttgggaaagaagcaaggtccttgtacgag
cgcggcatggaatctcttaaagccatgctgcccttgtatgatactggctccgggaccatc
tatgacctccgccacttcatgcttggcattgctcccaacctggcccgctgggactatcac
accacccacattaaccagctgcagctgctcagcaccatcgatgagtccccaatcttcaaa
gaatttgtcaagaggtggaaaagctaccttaaaggcagtagggcaaagcacaactag

DBGET integrated database retrieval system