KEGG   Mus musculus (mouse): 93687Help
Entry
93687             CDS       T01002                                 

Gene name
Csnk1a1, 2610208K14Rik, 4632404G05Rik, 5430427P18Rik, CK1a, Csnk1a
Definition
(RefSeq) casein kinase 1, alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu05165  Human papillomavirus infection
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    93687 (Csnk1a1)
   04340 Hedgehog signaling pathway
    93687 (Csnk1a1)
 09160 Human Diseases
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    93687 (Csnk1a1)
   05226 Gastric cancer
    93687 (Csnk1a1)
   05224 Breast cancer
    93687 (Csnk1a1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    93687 (Csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    93687 (Csnk1a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     93687 (Csnk1a1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   93687 (Csnk1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Pox_ser-thr_kin ABC1
Motif
Other DBs
NCBI-GeneID: 93687
NCBI-ProteinID: NP_001344427
MGI: 1934950
Ensembl: ENSMUSG00000024576
Vega: OTTMUSG00000035876
Position
18; 18 E1
AA seq 365 aa AA seqDB search
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtggaaaatacaaactggtg
cggaagatcggatctggctctttcggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggg
caagaaaaagactataatgtactagtcatggatctcctgggacccagccttgaagacctc
ttcaacttctgttcaaggaggttcactatgaagaccgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtccttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggcactgcccgatacgccagcatcaatgca
catcttggtattgagcagagtcgccgagatgacatggaatctttaggatatgttttgatg
tattttaatagaaccagtctgccgtggcaaggactgaaggctgcaacaaagaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaggtgttgtgtaaggggttt
cctgcagaatttgccatgtacttaaattactgtcgtgggctgcgctttgaggaagctccg
gattacatgtatctgaggcagctattccgcatccttttcaggaccctgaaccaccaatat
gactacacatttgattggacgatgttaaagcagaaagcagcccagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtttctaa

DBGET integrated database retrieval system