KEGG   Mus musculus (house mouse): 93704
Entry
93704             CDS       T01002                                 
Symbol
Pcdhgb7
Name
(RefSeq) protocadherin gamma subfamily B, 7
  KO
K16496  protocadherin gamma subfamily B
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    93704 (Pcdhgb7)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   93704 (Pcdhgb7)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2 Cadherin_3
Other DBs
NCBI-GeneID: 93704
NCBI-ProteinID: NP_291057
MGI: 1935199
Ensembl: ENSMUSG00000104063
UniProt: Q91XX3
Structure
Position
18:37884672..37974923
AA seq 929 aa
MGGSSARRKRPGRPQVLFILLLPLFCPALGQPVRYSIPEELDRGSVVGKLAKDLGLSVLE
VSARKLRVSAEKLHFSVDSESGDLLVKDRIDREQICKGRRKCELQLEAVLENPLNIFHVV
VEIEDVNDHAPQFPKDEINLEISESDSPGARTILESAKDLDIGMNSLSKYQLSPNDYFLL
LVKDNPDGSKYPELELQKMLDREAESTHHLMLTAVDGGDPPRTGTTQLRIRVVDANDNRP
VFSQDVYRVRLPEDLPPGTTVLRLKAMDQDEGINAEFTYSFLGVANKAQFSLDPITGDIV
TRQSLDFEEVEQYTIDVEAKDRGSLSSQCKVIIEVLDENDNRPEIIITSLSDQISEDSPS
GTVVALFKVRDRDSGENAEVMCSLSGNNPFKIHSSSNNYYKLVTDSILDREQTPGYNVTI
TATDRGKPPLSSSTTITLNVADVNDNAPVFQQQAYLINVAENNQPGTSITQVKAWDPDVG
SNGLVSYSIIASDLEPKALSSFVSVNQDSGVVYAQRAFDHEQIRSFQLTLQARDQGSPAL
SANVSMRVLVDDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNA
WLSYHVLQASDPGLFSLGLRTGEVRTARALSDKDAARQRLLVAVRDGGQPPLSATATLLL
VFADSLQEALPDLVDHPIPSDPQSELQFYLVVALALISVLFLLAVIFAIALRLRQSSSPS
STGCFGSVLGSKSRPVLPPNYSEGTLPYAYNLCVPGDQLKPEFNYFSSVGDCPAAQDILN
KDSSSALLASILTPGVEADEKTFNQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQF
DTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNAT
LTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgggagggagcagcgcgcggaggaagcgccccggccgcccgcaggtactgtttatcctg
ctgctgcctttgttctgtcccgcgctgggccagccggtccgctactccatccctgaggag
ctggaccgcgggtcggtggtggggaagctcgccaaggacctggggctcagtgtcctggaa
gtgtcggctcggaagctgcgggtcagcgctgagaagctgcacttcagcgtggattcggag
agcggggacttactggtgaaggaccgcatagatcgcgagcaaatatgcaaagggaggaga
aagtgtgagctgcagttggaagctgtgctagaaaaccctttaaatatttttcatgtcgtt
gtggagattgaggatgttaatgatcacgctcctcaatttccaaaagacgaaataaaccta
gagataagtgaatccgacagcccaggggcgagaacaattctggagtcagcaaaagatctt
gacattggtatgaattctctaagtaaataccagttaagtcctaacgactactttttattg
ttggtgaaagacaatcctgatggtagtaaatacccagaattagaattgcaaaagatgctg
gaccgagaagcagagagcacacaccacctgatgctgactgctgtagatggtggggacccg
ccccgtactggtactactcagctccgaatccgagtggtggacgccaatgataaccgccca
gtgttcagccaagacgtgtacagagtccgccttccagaagacttgcctccaggaaccaca
gtcctaaggctaaaggcaatggatcaagacgagggcatcaatgcagaatttacatattcc
ttcctaggtgtggctaacaaagcccagttctctctggatcccataacaggagatattgta
actcgccagtcgttggattttgaagaagtagagcaatatacgattgatgtggaggcaaag
gaccgaggatctctttcttcacagtgtaaagtaattatagaggttctagatgagaacgac
aaccgcccagaaataatcatcacttctctctctgatcagatttcggaggattctccttcc
ggaactgttgtggccctcttcaaggtacgggatcgagattctggggaaaacgcagaagtc
atgtgcagtttaagcggaaacaatccatttaagattcattcttcttccaacaattactac
aagttagtaacagatagcatcctagaccgggaacagaccccagggtacaacgttactatc
acagccactgataggggcaagccgcccctttcctccagcacaaccatcactctgaacgtc
gctgatgtcaacgacaatgcacctgttttccaacagcaggcctacctgataaacgtagca
gaaaacaaccagcccggtacctccataacccaagtcaaagcatgggatccagatgtggga
tccaatggcctcgtctcctactccatcatagccagcgacctagaaccaaaagcgctgtcg
tccttcgtgtccgtgaaccaggacagtggagtagtgtacgcgcagcgtgcctttgaccat
gagcagattcgctccttccagctgactttacaagcgcgagaccaggggtcgcctgcgctc
agcgccaacgtgagcatgcgcgtgctggtggacgaccgcaacgacaacgcgccacgcgtg
ctgtatcccacgctggagcccgatggctctgcactcttcgacatggtaccccgtgccgct
gagcctggatacctggtcaccaaagtggtggctgtggatgcagactcaggacacaatgcc
tggctgtcttaccacgtgctgcaggccagcgatcccggtctcttcagcctggggctgcgc
acgggcgaggtgcgcacagcgcgtgccttgagcgacaaggatgcagctcgtcagcgcctt
ctggtcgctgtgcgtgatggtggacagccacctctgtctgccactgctacactgctccta
gtttttgcagacagcctacaagaagcgttgccagacctcgtcgatcatcccatcccctcc
gaccctcagagtgagcttcagttttacctggtggtggctttggccttgatctcagtgctt
ttccttctcgcagtaattttcgccattgctttgcgcctgcgacagtcttccagcccttca
tccactggttgctttgggtcggttcttggttccaaatctagaccagtacttccacccaac
tacagcgagggaacattgccctatgcctataatctgtgcgtgccgggagatcaacttaaa
ccagaatttaattacttctcatccgttggagattgtccagccgcacaagatattctcaac
aaagatagctcctcggcactgttggctagtattttaactcctggtgttgaagcagacgag
aagacctttaaccagcaagccccgcccaacactgactggcgtttctctcaagcccagaga
cccggcacgagcggatcccaaaatggtgatgaaactggcacctggcccaacaaccagttt
gatacagagatgctgcaagccatgatcttggcctctgccagcgaagctgctgatgggagc
tctaccctgggagggggcgctggcaccatgggtctgagcgctcgatacggaccccagttt
accctgcagcacgtgcctgactaccgccagaacgtgtacatccctggcagcaatgccacg
ctgaccaatgccgctggcaaacgagatggcaaggctccagcaggtggtaatggcaacaag
aagaaatcgggcaagaaagagaagaagtaa

DBGET integrated database retrieval system