KEGG   Mus musculus (house mouse): 93717
Entry
93717             CDS       T01002                                 
Symbol
Pcdhga9
Name
(RefSeq) protocadherin gamma subfamily A, 9
  KO
K16495  protocadherin gamma subfamily A
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    93717 (Pcdhga9)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   93717 (Pcdhga9)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2 RET_CLD1 Cadherin_3
Other DBs
NCBI-GeneID: 93717
NCBI-ProteinID: NP_291070
MGI: 1935226
Ensembl: ENSMUSG00000102440
UniProt: Q91XX9
Structure
Position
18:37869989..37974916
AA seq 932 aa
MAAAPARRPHCRELVVLCALLGMLWEARAGQIRYSVPEETEKGYIVGNISKDLGLEPREL
AERGVRIISKGKTQLFSLSPRSGSLVTAGRIDREELCAQSATCLLNFKVLVEDRVKLYGV
EVEVVDINDNAPKFEAENLFVKISEIAAPGARYPLPEAVDPDVGINSLQSYQLSPNRHFS
LHLQTGDDGTINPELVLERTLDREEEPTHHLVLTAYDGGNPRRSSTALIQVTVLDTNDNA
PVFDQPVYRVKVLENVAPGTLLLTVRASDPDEGANGKVTYKFRKINEKHSLLFHLHENTG
EMTVAKNLDYEECSLYEMEIQAEDGGGLKGRTKVVVMVEDVNDNRPEVTITSLFSPVRED
APPGTVILLFNAHDQDSGKNGQVVCSIQENPSFKLENSVDDYYRLLTAQILDREKASEYN
ITVTATDRGTPSMSTEVHITLYVADINDNPPAFSQTSYSVYLPENNPRGTSIFSVSAHDP
DDEENAKVTYSLVENTIQGAPLSSYVSINSDTGVLYALQSFDYEQFQNLQMQVKASDNGH
PPLSSNVSLSVFLLDQNDNAPKILYPSLPTDGSTGVELAPRSAEAGYLVTKVVAVDKDSG
QNAWLSYRLLKASEPGLFTVGLRSGEIRTARALLERDALKQSLVVAVQDHGQPPLSATIT
LTVAVADSIPDILADLGSINTPADPDSDITLYLVVAVAVVSCVFLLFVLVLLALRLRRWH
ASHLLQDAMGGSTGVPTSHIVGVHGVQTFLQTYSQEFSLTPDSGKSHLIFPQPNYADTLI
SQESCGKSEPLCSSVEPKFPIDDTPLVPQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGS
NATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2799 nt   +upstreamnt  +downstreamnt
atggctgctgcccccgccagacgcccgcactgcagagaactggtcgtcttgtgtgcactg
ctagggatgctgtgggaggccagggccgggcaaatccgctattccgtgccagaagagaca
gaaaagggctatatagtgggaaacatctctaaggacctgggactggagccccgtgagctg
gcagagcgcggagtccgcatcatctccaaaggtaagacccagcttttctctctgagtccg
cggagcggcagcttggtcaccgcaggcaggatagaccgggaggagctgtgcgctcagagc
gcgacttgtctcctaaactttaaagtcctagttgaggacagagtgaaactttatggggtg
gaagtagaagtggttgatatcaatgacaatgcgccaaaatttgaggccgaaaatttgttt
gtaaaaatcagtgaaatcgctgcccccggagcaaggtatccactcccagaagcggttgac
ccagatgtgggcataaactccctccagagttaccagctcagccccaatcgccacttctct
ctccacctgcaaactggagacgacggaactataaacccagagctggtgctggagcgcacc
ctggaccgagaggaagaacccactcaccacctggtcctcaccgcctacgatggcggcaac
ccacgccgctccagcacagcgctcatccaggtcacagtgttggatactaacgataatgcc
cctgttttcgaccaaccggtttaccgcgtgaaagtccttgagaatgtggccccgggcacc
ctgctgctcacagtgagagctagcgacccggatgagggtgccaatgggaaggtgacatac
aaattccggaaaattaatgaaaagcattcgctgttgtttcatcttcatgaaaacactggg
gaaatgacagtagcgaaaaatctggactatgaagaatgttcgttgtatgaaatggaaata
caggctgaagatggtgggggactgaaagggcggaccaaagtggtagttatggtagaagat
gtaaatgacaatcggccggaagtgaccattacctctctgtttagcccagtaagggaagat
gcgcccccagggacagtaatcctccttttcaatgctcatgaccaagattctgggaagaat
gggcaagttgtctgttccatccaggagaacccatcctttaaattagaaaactcagtagac
gattactataggttgttgacagcccagatccttgatcgagaaaaggcttctgagtataac
atcacagtgacagcaacagacaggggaaccccatccatgtccacagaagttcacatcacc
ctgtatgtggctgacatcaatgacaatcctcctgccttctctcaaacctcctactcagtc
tatctccccgaaaacaaccccagaggcacctccatcttctcagttagcgcccatgaccct
gacgacgaggagaatgctaaggttacttactctttggtggaaaacaccatccagggggca
ccactctcctcctacgtctccattaattctgacactggcgtgctctatgctctgcaatcc
tttgactatgagcagtttcaaaaccttcaaatgcaggtgaaggcgagtgacaacgggcac
ccgccactcagcagcaatgtgtccctgtctgtgtttctattggatcagaatgacaatgct
cccaagatcctgtatccctccctcccgactgacggttccactggtgtggaactggctccc
cgctcagcagaggctgggtatctggtgaccaaggtggtggcagtggacaaagactctgga
cagaatgcttggttgtcttaccgtctgctcaaagctagtgagccaggacttttcacagtg
gggctacgctcaggcgaaatacgcacagctcgggccctgctagagagagatgcactcaag
caaagcctcgtggtagctgtgcaggaccatggccagccacctctttcagctaccatcact
ctcacagtggctgtggcagacagcatccctgacatcctagctgacttgggcagtatcaac
actcctgcagaccccgattctgacattactctctacctggtggtagcagttgctgtggtc
tcctgtgtcttcctactctttgtgctagtgctgctggcccttaggctacggcgctggcat
gcttcgcacctgctgcaggatgcaatgggcggatccactggggtaccaacatcacatatt
gtgggtgtgcatggggttcagactttcctacaaacctattctcaagagttttccctcaca
cctgactctgggaagagccacctgatcttcccccagcccaactacgcagacacactcatc
agccaggagagctgtgggaagagtgaacctctgtgcagttcagttgagcccaagtttcct
attgatgacactcctttggttcctcaagccccgcccaacactgactggcgtttctctcaa
gcccagagacccggcacgagcggatcccaaaatggtgatgaaactggcacctggcccaac
aaccagtttgatacagagatgctgcaagccatgatcttggcctctgccagcgaagctgct
gatgggagctctaccctgggagggggcgctggcaccatgggtctgagcgctcgatacgga
ccccagtttaccctgcagcacgtgcctgactaccgccagaacgtgtacatccctggcagc
aatgccacgctgaccaatgccgctggcaaacgagatggcaaggctccagcaggtggtaat
ggcaacaagaagaaatcgggcaagaaagagaagaagtaa

DBGET integrated database retrieval system