KEGG   Mus musculus (mouse): 93730Help
Entry
93730             CDS       T01002                                 

Gene name
Lztfl1, 5530402H04Rik, 6130400H19Rik, AI414725, AW048545
Definition
(RefSeq) leucine zipper transcription factor-like 1
  KO
K19400  leucine zipper transcription factor-like protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    93730 (Lztfl1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBSome complex
    93730 (Lztfl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Leu_zip SesA Hom_end_hint
Motif
Other DBs
NCBI-GeneID: 93730
NCBI-ProteinID: NP_201579
MGI: 1934860
Ensembl: ENSMUSG00000025245
Vega: OTTMUSG00000035821
UniProt: Q9JHQ5
Position
9 F4; 9 74.36 cM
AA seq 299 aa AA seqDB search
MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKDSRLVEETFTIDEVSEVLNG
LQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKA
EFVSSSKKPIIDITKPKLVPINEGGTTELLNKEILRLQQENEKLKSRLKTIEIQAVNALD
EKSKLERVLQDLQLDQENQQDLLKAQDLDDLENTVATLRSEFQKTLNDKTENQKSLEENL
AAAKHDLLRVQEQLSMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAKYESED
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttgggcctaaatgagcaccatcaaaatgaggtcattaattacatgcgtttt
gctcgttcaaaaagaggcttgagacttaaaacggtagattcctgctttcaggacctcaag
gacagcaggctggtggaggagactttcaccattgatgaggtttcagaagtcctaaatggg
ctgcaggctgtggtacacagtgaggtggagtccgagctcatcaatacagcttacaccaat
gtcctgctcctacggcagctgttctcccaagctgagaagtggtatctaaagctacagaca
gacatctctgaacttgaaaacagagaattattagaacaagttgctgaatttgaaaaggca
gaatttgtatcttcaagtaaaaagcccatcatagatatcacaaagcctaaacttgttcca
attaatgaaggtggaactacagagctcctaaacaaggaaattttaagacttcaacaagag
aatgaaaaactaaagtcaaggctgaagaccattgaaatacaggctgtaaatgctctggat
gagaagtcaaaattggaaagagtacttcaagatttacagctcgatcaagaaaaccaacag
gatttgctaaaggcccaagacttggatgacttggaaaatacagttgcaactcttaggagt
gaatttcagaagacacttaatgacaagacagaaaaccaaaaatctttggaagagaaccta
gcagcagccaaacatgacctcctcagagtacaggagcagctgagcatggctgaaaaggag
ttagagaagaaatttcaacaaacagcagcttatcgaaacatgaaagagattctcaccaaa
aagaatgatcaaatcaaagacctacggaaaagactggcaaaatatgaatctgaagattaa

DBGET integrated database retrieval system