KEGG   Mus musculus (mouse): 93736Help
Entry
93736             CDS       T01002                                 

Gene name
Aff4, AF5Q31, Alf4, Laf4l, MCEF
Definition
(RefSeq) AF4/FMR2 family, member 4
  KO
K15185  AF4/FMR2 family member 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    93736 (Aff4)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     93736 (Aff4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AF-4
Motif
Other DBs
NCBI-GeneID: 93736
NCBI-ProteinID: NP_291043
MGI: 2136171
Ensembl: ENSMUSG00000049470
Vega: OTTMUSG00000000053
UniProt: Q9ESC8
Position
11; 11 B1.3
AA seq 1160 aa AA seqDB search
MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYD
EMKDYIGDRSIPKLVAIPKPAVPTTTDEKANPNFFEQRHGGSHQSSKWTPVGPAPSTSQS
QKRSSALQSGHSSQRSGAGGSGASSSGQRHDRDSYSSSRKKGQHGSEHSKSRSSSPGKPQ
AVSSLSSSHSRSHGNDHHSKEHQRSKSPRDPDANWDSPSRGPFSSGQHSSQSFPPSLMSK
SSSMLQKPTAYVRPMDGQESVEPKLSSEHYSSQSHGNSMTELKPSSKAHLTKLKIPSRPL
DASVSGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKESQQSNFGPGEQKRY
STAKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSEGADNSR
DDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHK
VSPASSVDSNIPSSQAYKKEGREQGTASNYTDPGGTKETSSATPGRDSKTIQKGSESGRG
RQKSPAQSDSTTQRRTVGKKQPKKPEKSAAEEPRGGLKIESETPVDMAASMPSSRHKAAT
KGSRKPNIKKESKSSPRPTAEKKKYKSASKPSQKSREIIETDTSSSDSDGSESLPPSSQT
PKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKIDLNLLTR
IPGKPYKETEPPKGEKKNVPEKHSREVQKQASEKASNKGKRKHKNDDDTRASESKKPKTE
DKNSSGHKPSSSRESSKQSSTKEKDLLPSPAGPILSKDSKTEHGSRKRTVSQSSSLKSSG
TSSKENSGSSSKSSSSSTAKQKKTEGKGPSSSKEAKEKAPNSSSNCPPSTPTSESSKPRR
TKLAFDDRNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQES
KSPFPMYSDTVELIKYTMKLKNYLAPDATAADKRLTVLCLRCQSLLYLRLFKLKKENALK
YSKTLTEHLKNSYSNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGSYSSGGSSASASGSSV
TIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTD
LARYTRQGLHWLRQDAKLIS
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgaagaccggaatgtgctgcgcatgaaagaaagggaaaggcggaatcaggaa
attcagcagggtgaagacgccttcccacctagttctcctctctttgctgagccatacaaa
gtcactagcaaagaagataagttatcaagtcggattcagagcatgcttggaaactacgat
gaaatgaaggattacataggagacagatcgataccaaagcttgttgcaattcccaagcct
gcagtaccaacgaccacagacgagaaagcaaacccaaatttttttgagcagagacatgga
ggatctcatcagagtagcaaatggactcctgtaggccccgcccccagcacctctcagtct
cagaaacgctcctctgccctgcagagtggacacagcagccaacggagtggtgcaggaggg
agtggcgccagcagcagtggccagaggcatgaccgtgactcctacagcagtagcaggaaa
aaaggccagcacggctcagagcactccaaatctcgatcctcaagccctggaaaaccccag
gctgtttcttcattaagttctagtcattccaggtctcatgggaatgatcaccatagcaag
gaacatcagcgctccaaatcacctcgggaccctgatgccaactgggattctccttcccgc
ggacctttttcaagtgggcaacattcaagtcagtctttcccaccttctttgatgtcaaaa
tctagttcaatgttacagaaacccactgcctatgtacggcccatggatggacaggagtct
gtggaaccaaagctgtcctctgagcactacagcagccagtctcatggtaatagcatgact
gagctgaagcccagcagcaaagcacatctcaccaagctgaaaattccttcccgacctttg
gatgcatcggtttctggtgatgtaagctgtgtagatgaaatacttaaagagatgacgcat
tcatggcctccccctctaacggctattcatacaccatgcaaaacagaaccttccaaattc
ccttttccaactaaggagtcgcaacagtctaactttggccctggagaacaaaaaagatac
agtactgctaaaacatcaaatggacaccagtcaaaatctatgttaaaagatgacttaaaa
ctaagcagcagtgaagacagtgatggggaacaggattgtgataagacaatgccaaggagt
acaccaggaagtaactctgaaccttcacaccataacagtgagggagcagacaactccagg
gatgactcgagcagccacagtggatctgagagcagctctgggtctgactcggagagtgag
agcagctccagtgacagtgaggctaatgagccgtcgcagagcgcatctcctgagcctgaa
ccaccaccaacaaacaagtggcaacttgataattggttgaataaagtgaacccacataaa
gtatccccagcttcctctgtagacagcaacatcccatcttctcaagcctacaagaaagaa
ggccgggagcagggcactgccagtaactacacagatccaggggggacaaaagaaacgagc
tctgccaccccaggacgagactctaaaaccatccaaaagggatcagaaagtggccgtggg
aggcagaagtctcctgcacagagcgacagtaccactcagaggagaactgtcggcaaaaaa
caacccaaaaaacctgagaagtcagctgctgaagagcctcgtggaggcctgaagatagaa
agtgagacccctgtggacatggctgccagcatgccctccagcaggcacaaagcagccacc
aagggctcgaggaaacccaacatcaaaaaggaatcaaaatcttctcctcgacctacggca
gagaagaagaagtacaagtcagccagtaaaccgtcccagaagtctcgggagatcatagag
actgacacctcgtcctcagactcggacggcagcgagagcctgcctccctcctcacagact
cctaagtaccctgaaagcaacaggactcctgtcaaaccctcctcagtggaggaagaagat
agcttttttcggcaacgaatgttctctcctatggaagagaaggagctcctttccccactc
agtgagcctgatgacaggtatccactcattgtgaagattgacctcaatcttctgactcga
atacccgggaagccttacaaagaaacagagccacccaagggggaaaagaaaaatgttcca
gagaaacactcgagagaggtgcagaagcaagcctcagaaaaggcttccaacaaaggcaag
aggaaacacaagaatgatgatgatacccgagccagtgagagcaaaaaacccaaaacagag
gacaagaactcatcaggccacaagccatccagcagcagagagtcatctaagcagagtagt
acaaaagaaaaggacttgctaccttcacctgctgggcccattctttcaaaagattcaaaa
acagagcatggttctcggaagaggactgtcagtcagtcgtcgtccttaaagtccagtggg
accagcagcaaagagaacagtggcagcagcagcaagagcagctcctcctccacagcgaag
cagaagaagactgaaggcaagggtcccagcagctccaaggaggccaaggagaaggctcca
aatagctcctctaattgtcctccgtctacaccaacttctgagtcttcgaagcctcggaga
acaaagcttgcctttgatgacagaaattattcagcagaccattatttacaagaagcaaaa
aaactcaaacacaatgcagatgctttgtctgacaggtttgagaaagccgtgtactacctt
gatgctgtagtgtctttcattgagtgtgggaatgcattagagaagaacgctcaggaatcc
aagtccccattccctatgtactcagacacggtggagctcattaagtacactatgaaacta
aagaattatttggcaccagatgctacagctgcagacaagagactcacagtactttgcctg
agatgccagtcattattgtacctgaggctgttcaaactgaagaaggagaacgctctcaag
tactccaagacgctaactgagcacctgaagaattcttacagtaattctcaagcaccttca
cccggcttggggagcaaagctgttgggatgccctcccctgtttctccaaaactgtcacca
ggcaattctggaagttactcttctgggggaagtagtgcttcagcaagtggttcttcagtg
accattccacagaaaatccaccagatggcagcaagctatgtccaggttacatctaacttc
ctctatgccacagaaatttgggaccaagctgaacagctttccaaagaacaaaaagaattc
tttgctgaactggacaaagtgatgggccctctcatctttaatgcaagcatcatgacagat
ctggctcgttacacccggcagggactgcattggcttcggcaggatgccaagctgatatct
tga

DBGET integrated database retrieval system