KEGG   Mus musculus (house mouse): 93737
Entry
93737             CDS       T01002                                 
Symbol
Pard6g, 2410049N21Rik, Par6a
Name
(RefSeq) par-6 family cell polarity regulator gamma
  KO
K06093  partitioning defective protein 6
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04144  Endocytosis
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    93737 (Pard6g)
   04390 Hippo signaling pathway
    93737 (Pard6g)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    93737 (Pard6g)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    93737 (Pard6g)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    93737 (Pard6g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    93737 (Pard6g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    93737 (Pard6g)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     93737 (Pard6g)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 93737
NCBI-ProteinID: NP_444347
MGI: 2135606
Ensembl: ENSMUSG00000056214
UniProt: Q9JK84 Q8CBL3
Position
18:80090045..80162855
AA seq 382 aa
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYQLVVHTHHISNTEV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEADHYSFGAGTLSRKKKVLVT
LRDDGLRRRPHLNISMPHDFRPVSSIIDVDILPETHRRVRLYRHGYEKPLGFYIRDGTSV
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRSSRTSGSSVHSTDSTTSHHSLPGAHVLQNSEDVESDEEADIV
IEGALEPQHIPKTQAVPPGSLSRANGTSLAHGLHRRDMSLHSSGRESNGSIHRFLSSLKP
DPRHSLVLPQGGVEEHGPAITL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaccggagttttcataagtctcagaccctacgcttctacgactgcagcgctgtggaa
gtcaagagcaagtttggcgccgagttccgaaggttctccttggaccgccacaagcctggg
aagtttgaagatttctaccagctggtggtgcacacccaccacatctctaacaccgaggtg
accatcggctatgctgatgtgcacggggacctgctgcccatcaacaatgacgacaacttc
tgcaaggcagtctcaagtgcaaaccccttgcttcgagtcttcatccagaaacgagaagaa
gcagaccattacagcttcggagcaggcactctgtcacggaagaaaaaggtgctggtgacc
ctgagggatgacggtctgcgtcggcgtccccacctcaacatcagcatgccgcatgacttc
cgcccagtgtcatccatcattgacgtggacatcctcccggagacgcaccgccgagtgagg
ctctacagacacggttatgagaagccactgggcttctacattcgagatggcaccagcgtg
cgggtgacgccccatgggctagaaaaggtaccaggtatcttcatttctcgaatggtaccc
gggggccttgcggagagcactgggctactggctgtgaatgatgaagtcctggaggtgaat
gggattgaggtagctggaaagaccttggatcaagtcacagacatgatgatagccaacagc
cacaacctcattgtcactgtcaagccggccaaccaaaggaacaatgtggtccgcagcagc
cgcacgtccggcagctctgtgcattccacagacagcaccaccagtcaccacagcctgcca
ggtgcccatgtcctgcagaattctgaggacgtggagagtgacgaggaagccgacattgtc
attgaaggggctctagaacctcaacacattcccaagacgcaggctgtacctccaggcagc
ctctccagggccaatggcaccagccttgctcacgggctgcacagaagggacatgagcctg
catagctctgggagggagagcaacggcagcatccacagatttctcagctctctgaagcca
gacccccgacacagcctggtcctcccccaaggaggggtggaggaacatgggccagccatt
acactctag

DBGET integrated database retrieval system