KEGG   Mus musculus (mouse): 93739Help
Entry
93739             CDS       T01002                                 

Gene name
Gabarapl2, 0610012F20Rik, 2900019O08Rik, AI173605, GATE-16, Gef2
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04136  Autophagy - other
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04371  Apelin signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04727  GABAergic synapse
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    93739 (Gabarapl2)
   04068 FoxO signaling pathway
    93739 (Gabarapl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    93739 (Gabarapl2)
   04136 Autophagy - other
    93739 (Gabarapl2)
   04137 Mitophagy - animal
    93739 (Gabarapl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    93739 (Gabarapl2)
  09156 Nervous system
   04727 GABAergic synapse
    93739 (Gabarapl2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    93739 (Gabarapl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    93739 (Gabarapl2)
   04121 Ubiquitin system [BR:mmu04121]
    93739 (Gabarapl2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    93739 (Gabarapl2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    93739 (Gabarapl2)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   93739 (Gabarapl2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    93739 (Gabarapl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg8 APG12
Motif
Other DBs
NCBI-GeneID: 93739
NCBI-ProteinID: NP_080969
MGI: 1890602
Ensembl: ENSMUSG00000031950
Vega: OTTMUSG00000031074
UniProt: P60521
Position
8; 8 E1
AA seq 117 aa AA seqDB search
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggatgtttaaggaggaccactctctggaacacagatgcgtggaatccgcgaag
atcagagcgaagtaccccgaccgagttccggtgatcgtggaaaaagtctcgggctctcag
attgttgacatagacaagaggaagtacttggtcccctcggacatcactgtggctcagttc
atgtggatcatcaggaaaaggatccagcttccctccgagaaggccatcttcctgtttgtg
gacaagacagtcccacagtccagcctaactatgggacagctttacgagaaggaaaaagat
gaagatggattcttgtatgtggcctacagcggagagaacacttttggcttctga

DBGET integrated database retrieval system