KEGG   Mus musculus (mouse): 93742
Entry
93742             CDS       T01002                                 

Gene name
Pard3, AA960621, AI256638, Asip, D8Ertd580, D8Ertd580e, P, PA, Par-3, Par3, Pard-3, Pard3a, Phip
Definition
(RefSeq) par-3 family cell polarity regulator
  KO
K04237  partitioning defective protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04144  Endocytosis
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    93742 (Pard3)
   04390 Hippo signaling pathway
    93742 (Pard3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    93742 (Pard3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    93742 (Pard3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    93742 (Pard3)
   04530 Tight junction
    93742 (Pard3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    93742 (Pard3)
  09158 Development and regeneration
   04360 Axon guidance
    93742 (Pard3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    93742 (Pard3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    93742 (Pard3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     93742 (Pard3)
SSDB
Motif
Pfam: PDZ PDZ_2 PDZ_6 TSGP1
Other DBs
NCBI-GeneID: 93742
NCBI-ProteinID: NP_001013599
MGI: 2135608
Ensembl: ENSMUSG00000025812
Vega: OTTMUSG00000034639
UniProt: Q99NH2 A0A0R4J1Y4
Structure
PDB: 
2KOJ 2KOH

Position
8 E2; 8 74.66 cM
AA seq 896 aa
MPLHVRRSSDPALTGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKK
DENYRSLPRDPSSWSNQFQRDNARSSLSASHPMVDRWLEKQEQDEEGTEEDSSRVEPVGH
ADTGLENMPNFSLDDMVKLVQVPNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEQE
NLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRARVIWFHVVPAANKEQYEQLSQREKN
NYSPGRFSPDSHCVANRSVANNAPQALPRAPRLSQPPEQLDAHPRLPHSAHASTKPPAAP
ALAPPSVLSTNVGSVYNTKKVGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILP
RGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPRE
MNAEPSQMQTPKETKAEDEDVVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHA
DLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAMETLRRSMSTEGNKRGM
IQLIVARRISRCNELRSPGSPAAPELPIETELDDRERRISHSLYSGIEGLDESPTRNAAL
SRIMGKCQLSPTVNMPHDDTVMIEDDRLPVLPPHLSDQSSSSSHDDVGFIMTEAGTWAKA
TISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLDFVKTRKSKSMDLGIA
DETKLNTVDDQRAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGNIPFHRPRPRIIRG
RGCNESFRAAIDKSYDKPMVDDDDEGMETLEEDTEESSRSGRESVSTSSDQPSYSLERQM
NGDPEKRDKTERKKDKAGKDKKKDREKEKDKLKAKKGMLKGLGDMFSLAKLKPEKR
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgcctcttcatgtccgccggagcagcgacccagctttaactggcctttccacttctgtc
agtgataacaacttttcctcagaggagccctccaggaaaaaccccacccgctggtccacg
acagctggctttctcaagcagaacaccgctggaagtcccaaaacctgcgacaggaagaaa
gatgaaaactacagaagccttccacgggatcccagtagctggtccaaccagttccagcga
gacaacgcccgctcctccctgagcgccagccacccaatggtagaccggtggctggagaag
caagaacaggatgaggaaggcacagaagaagacagcagccgagtggagccggttggacat
gctgataccggattggagaacatgcccaacttttccctcgatgatatggtaaagctcgta
caagtccccaacgatggagggcccctgggaatccatgtagtgcctttcagtgctcgaggc
ggcagaacattggggttgttagtgaagcggttggagaaaggcggtaaggctgagcaagaa
aaccttttccatgagaatgactgcattgtgaggattaacgatggagatcttcgaaacaga
agatttgagcaagcacaacatatgttccgccaagctatgcgtgcgcgtgtcatttggttc
catgtggtccctgcagcaaacaaggagcaatatgaacaactgtcccaacgcgagaagaac
aactactccccaggccgcttcagccctgacagccactgtgtggccaacaggagtgtggcc
aacaatgcccctcaagcattgcccagagcacccagactgagtcagccacccgagcagctg
gatgctcacccccgactacctcatagtgctcacgcctcaaccaaaccacccgcagccccg
gccttggctccacccagtgtgcttagtaccaacgtaggcagtgtgtacaacacgaagaaa
gtaggcaagaggctcaacatccagcttaagaaaggtacagaaggactgggattcagcatc
acctcccgggacgtcaccataggtggctcagctcccatttatgtcaagaatatccttcct
cgaggggctgccattcaggatggcagactcaaggcaggagaccggctaatagaggtcaat
ggagtagatttagcaggcaaatcccaggaggaagttgtttccctgttgagaagcaccaag
atggaggggactgtgagccttctggtctttcgtcaggaagaggctttccacccaagggaa
atgaatgctgaaccaagccagatgcagactccaaaagaaacgaaagctgaagatgaggac
gttgttctcacacccgatggtaccagggagtttctgacttttgaagttccactgaatgac
tcaggatctgcagggcttggtgtcagtgtcaaggggaaccgttccaaagagaaccacgca
gatttggggatcttcgttaaatccattatcaatggtggagctgcatctaaagatggaagg
ctgagggtaaatgaccagctgatagctgtgaatggagaatctctactgggcaaagccaac
caggaagccatggagactctacggaggtccatgtccaccgagggcaacaagcgtggcatg
atccagctcattgtggcgaggcggatcagcagatgtaacgagctgcggtctcctgggagc
cctgctgcacctgagctgcccatcgagacagaactggatgaccgagaacgcaggatctca
cactccctctacagtgggatcgaggggctggatgagtcgcccaccaggaacgcagcactg
agcaggataatgggtaaatgccagctgtcccccacggtgaacatgcctcacgatgacact
gtcatgattgaagatgacaggctgcctgtgctccctcctcacctctctgaccagtcctcc
tccagctcccatgatgacgttggattcataatgacagaagcaggcacgtgggccaaagct
accatcagtgactcagccgactgctcattgagtccagatgttgatccggttctcgctttt
caacgggaaggatttggacgccagagtatgtcagaaaaacgcacaaagcaattttcagat
gccagtcaattggatttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagct
gacgagactaaactcaatacagtggatgaccagagagcaggctctcccagtagagatgtg
ggaccctccttaggtctgaagaaatctagctccttagaaagtctgcagaccgctgtcgcc
gaggtgacgctgaacgggaacattcctttccaccgccctcggccacgaatcatccgggga
aggggctgcaacgaaagcttcagagccgccattgacaagtcctacgacaagcccatggtt
gatgatgacgacgaaggcatggagaccttggaagaagacacagaggaaagctcgaggtca
gggagggagtccgtgtccacgtccagcgatcagccttcctattctctggagaggcaaatg
aatggagacccagagaaaagggacaagacagagaggaaaaaggacaaagccggaaaggat
aagaagaaagaccgagagaaggagaaggataaactgaaagccaagaaggggatgctgaaa
ggcttgggggacatgttcagcctggccaaactgaagccggagaagagatga

DBGET integrated database retrieval system