KEGG   Mus musculus (mouse): 93759
Entry
93759             CDS       T01002                                 

Gene name
Sirt1, AA673258, SIR2L1, Sir2, Sir2a, Sir2alpha
Definition
(RefSeq) sirtuin 1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04922  Glucagon signaling pathway
mmu05031  Amphetamine addiction
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    93759 (Sirt1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    93759 (Sirt1)
   04152 AMPK signaling pathway
    93759 (Sirt1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    93759 (Sirt1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    93759 (Sirt1)
  09149 Aging
   04211 Longevity regulating pathway
    93759 (Sirt1)
   04213 Longevity regulating pathway - multiple species
    93759 (Sirt1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    93759 (Sirt1)
  09165 Substance dependence
   05031 Amphetamine addiction
    93759 (Sirt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    93759 (Sirt1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    93759 (Sirt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     93759 (Sirt1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     93759 (Sirt1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    93759 (Sirt1)
SSDB
Motif
Pfam: SIR2 DUF592
Other DBs
NCBI-GeneID: 93759
NCBI-ProteinID: NP_062786
MGI: 2135607
Ensembl: ENSMUSG00000020063
Vega: OTTMUSG00000030914
UniProt: Q923E4 Q3USJ2 Q3USY7 Q53Z05
Position
10; 10 B4
AA seq 737 aa
MADEVALALQAAGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAVAPAAAG
CEAASAAAPAALWREAAGAAASAEREAPATAVAGDGDNGSGLRREPRAADDFDDDEGEEE
DEAAAAAAAAAIGYRDNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFV
QQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVK
LLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRP
FFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFAT
ASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKY
DKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINE
LCHRLGGEYAKLCCNPVKLSEITEKPPRPQKELVHLSELPPTPLHISEDSSSPERTVPQD
SSVIATLVDQATNNNVNDLEVSESSCVEEKPQEVQTSRNVENINVENPDFKAVGSSTADK
NERTSVAETVRKCWPNRLAKEQISKRLEGNQYLFVPPNRYIFHGAEVYSDSEDDVLSSSS
CGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDTERPECAGGSGFGADGGDQEVVNEA
IATRQELTDVNYPSDKS
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggcggacgaggtggcgctcgcccttcaggccgccggctccccttccgcggcggccgcc
atggaggccgcgtcgcagccggcggacgagccgctccgcaagaggccccgccgagacggg
cctggcctcgggcgcagcccgggcgagccgagcgcagcagtggcgccggcggccgcgggg
tgtgaggcggcgagcgccgcggccccggcggcgctgtggcgggaggcggcaggggcggcg
gcgagcgcggagcgggaggccccggcgacggccgtggccggggacggagacaatgggtcc
ggcctgcggcgggagccgagggcggctgacgacttcgacgacgacgagggcgaggaggag
gacgaggcggcggcggcagcggcggcggcagcgatcggctaccgagacaacctcctgttg
accgatggactcctcactaatggctttcattcctgtgaaagtgatgacgatgacagaacg
tcacacgccagctctagtgactggactccgcggccgcggataggtccatatacttttgtt
cagcaacatctcatgattggcaccgatcctcgaacaattcttaaagatttattaccagaa
acaattcctccacctgagctggatgatatgacgctgtggcagattgttattaatatcctt
tcagaaccaccaaagcggaaaaaaagaaaagatatcaatacaattgaagatgctgtgaag
ttactgcaggagtgtaaaaagataatagttctgactggagctggggtttctgtctcctgt
gggattcctgacttcagatcaagagacggtatctatgctcgccttgcggtggacttccca
gacctcccagaccctcaagccatgtttgatattgagtattttagaaaagacccaagacca
ttcttcaagtttgcaaaggaaatatatcccggacagttccagccgtctctgtgtcacaaa
ttcatagctttgtcagataaggaaggaaaactacttcgaaattatactcaaaatatagat
accttggagcaggttgcaggaatccaaaggatccttcagtgtcatggttcctttgcaaca
gcatcttgcctgatttgtaaatacaaagttgattgtgaagctgttcgtggagacattttt
aatcaggtagttcctcggtgccctaggtgcccagctgatgagccacttgccatcatgaag
ccagagattgtcttctttggtgaaaacttaccagaacagtttcatagagccatgaagtat
gacaaagatgaagttgacctcctcattgttattggatcttctctgaaagtgagaccagta
gcactaattccaagttctataccccatgaagtgcctcaaatattaataaatagggaacct
ttgcctcatctacattttgatgtagagctccttggagactgcgatgttataattaatgag
ttgtgtcataggctaggtggtgaatatgccaaactttgttgtaaccctgtaaagctttca
gaaattactgaaaaacctccacgcccacaaaaggaattggttcatttatcagagttgcca
ccaacacctcttcatatttcggaagactcaagttcacctgaaagaactgtaccacaagac
tcttctgtgattgctacacttgtagaccaagcaacaaacaacaatgttaatgatttagaa
gtatctgaatcaagttgtgtggaagaaaaaccacaagaagtacagactagtaggaatgtt
gagaacattaatgtggaaaatccagattttaaggctgttggttccagtactgcagacaaa
aatgaaagaacttcagttgcagaaacagtgagaaaatgctggcctaatagacttgcaaag
gagcagattagtaagcggcttgagggtaatcaatacctgtttgtaccaccaaatcgttac
atattccacggtgctgaggtatactcagactctgaagatgacgtcttgtcctctagttcc
tgtggcagtaacagtgacagtggcacatgccagagtccaagtttagaagaacccttggaa
gatgaaagtgaaattgaagaattctacaatggcttggaagatgatacggagaggcccgaa
tgtgctggaggatctggatttggagctgatggaggggatcaagaggttgttaatgaagct
atagctacaagacaggaattgacagatgtaaactatccatcagacaaatcataa

DBGET integrated database retrieval system