KEGG   Mus musculus (mouse): 93760Help
Entry
93760             CDS       T01002                                 

Gene name
Arid1a, 1110030E03Rik, BAF250a, Osa1, Smarcf1
Definition
(RefSeq) AT rich interactive domain 1A (SWI-like)
  KO
K11653  AT-rich interactive domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    93760 (Arid1a)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    93760 (Arid1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    93760 (Arid1a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    93760 (Arid1a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     93760 (Arid1a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    93760 (Arid1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAF250_C ARID
Motif
Other DBs
NCBI-GeneID: 93760
NCBI-ProteinID: NP_001074288
MGI: 1935147
Ensembl: ENSMUSG00000007880
Vega: OTTMUSG00000011035
UniProt: A2BH40
Position
4; 4 D2.3
AA seq 2283 aa AA seqDB search
MAAQVAPAAASSLGNPPPPPSELKKAEQQQREEAGGEAAAAAAERGEMKAAAGQESEGPA
VGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLPEPPG
GGGGGGSSSSDGVGAPPHSAAAALPPPAYGFGQAYGRSPSAVAAAAAAVFHQQHGGQQSP
GLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPPQAYALSSPRGGTP
GSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLL
TSPSSARGYQGYPGGDYGGGPQDGGAGKGPADMASQCWGAAAAAAAAAAAVSGGAQQRSH
HAPMSPGSSGGGGQPLARTPQSSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYP
GQPYGSQTPQRYPMTMQGRAQSAMGSLSYAQQIPPYGQQGPSAYGQQGQTPYYNQQSPHP
QQQPPYAQQPPSQTPHAQPSYQQQPQTQQPQLQSSQPPYSQQPSQPPHQQSPTPYPSQQS
TTQQHPQSQPPYSQPQAQSPYQQQQPQQPASSSLSQQAAYPQPQPQQSQQTAYSQQRFPP
PQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSP
GVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAV
PGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYTSPQPGSALSPRQPSGG
QMHSGVGSYQQNSMGSYGPQGSQYGPQGGYPRQPNYNALPNANYPNAGMAGSMNPMGAGG
QMHGQPGIPPYGTLPPGRMAHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQESAV
AMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYPMGGTMANNSA
GMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPE
RKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATN
LNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSG
SMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFPDGSDPTF
QKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDP
YSRAAGPGLGSVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMGTGAPQPNLMPSTPDSGMY
SPSRYPPQQQQQQQQQHDSYGNQFSTQGTPSSSPFPSQQTTMYQQQQQNYKRPMDGTYGP
PAKRHEGEMYSVPYSAGQGQPQQQQLPAAQSQPASQPQAAQPSPQQDVYNQYSNAYPASA
TAATDRRPAGGPQNQFPFQFGRDRVSAPPGSSAQQNMPPQMMGGPIQASAEVAQQGTMWQ
GRNDMTYNYANRQNTGSATQGPAYHGVNRTDEMLHTDQRANHEGPWPSHGTRQPPYGPSA
PVPPMTRPPPSNYQPPPSMPNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPP
VPASHIAPTPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSG
LLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDP
GQRTLLDPGRFTKVYSPAHTEEEEEEHLDPKLEEEEEEGVGNDEEMAFLGKDKPSSENNE
EKLVSKFDKLPVKIVQRNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESK
IELLPSRPYVPCPTPPRKHLTTVEGTPGTTEQEGPPPDGLPEKRITATMDDMLSTRSSTL
TDEGAKSAEATKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCV
CVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVS
CDKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDP
FSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPV
CREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPP
FEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLI
GQS
NT seq 6852 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcaggtcgcccccgccgccgccagcagcctgggcaacccgccgccgccgccc
tcggagctgaagaaagccgagcagcaacagcgggaggaggcggggggcgaggcggcggcg
gcagcggccgagcgcggggaaatgaaggcagccgccgggcaggagagcgagggccccgcc
gtggggccgccgcagccgctgggaaaggagctgcaggacggggccgagagcaatgggggt
ggcggcggcggcggagccggcagcggcggcgggcccggcgcggagccggacctgaagaac
tcgaacgggaacgcgggccctaggcccgccctgaacaataacctcccggagccgcccggc
ggcggcggcggcggcggcagcagcagcagcgacggggtgggggcgcctcctcactcggcc
gcggccgccctgccgcccccagcctacggcttcgggcaagcctacggccggagcccgtct
gccgtcgccgccgcggcggccgccgtcttccaccaacaacatggcggacaacaaagccct
ggcctggcagcgctgcagagcggcggcggcgggggcttggagccctacgccgggccccag
cagaactcgcacgaccacggcttccccaaccaccagtacaactcctactaccccaaccgc
agcgcctaccccccgcctccccaggcctacgcgctgagctccccgagaggtggcactccg
ggctccggcgcggcggcggccgccggctccaagccgcctccctcctccagcgcctctgcc
tcctcgtcgtcttcgtccttcgcacagcagcgcttcggggccatggggggaggcggcccc
tcagcggccggcgggggaactccccagcccaccgccacccccaccctcaaccaactgctc
acgtcgcccagctcggcccgtggctaccagggctaccccgggggcgactacggcggcggg
ccccaggacgggggcgcgggcaaaggcccggcggacatggcctcgcagtgctggggggct
gcggcggcggcggcggcggcggcagcggccgtctcgggaggggcccaacaaaggagccac
cacgcgcccatgagccccgggagcagcggcggcggggggcagccgctcgcccggacccct
cagtcatccagtccaatggatcagatgggaaagatgagacctcagccgtatggtgggact
aacccatactcgcaacaacagggacctccttcaggaccgcaacaaggacatgggtaccca
gggcagccatatgggtcccagactccacagcggtaccccatgaccatgcagggccgggct
cagagtgccatgggcagcctctcttatgcacagcagattccaccttatggccagcaaggc
cccagtgcgtatggccagcagggccagactccatactataaccagcaaagtcctcatccc
cagcagcagccaccttacgcccagcaaccaccatcccagacccctcatgcccagccttcg
tatcagcagcagccgcagactcagcaaccacagcttcagtcctctcagcctccatattcc
cagcagccatcccagcctccacatcagcagtccccaactccatatccctcccagcagtcc
accacacaacagcatccccagagccagcccccctactcacaaccacaggcacagtctccc
taccagcagcagcaacctcagcagccagcatcctcgtcgctctcccagcaggctgcatat
cctcagccccagcctcagcagtcccagcaaactgcctattcccagcagcgcttccctcca
ccacaggagctttctcaagattcatttgggtctcaggcatcctcagccccctcaatgacc
tccagtaagggagggcaagaagatatgaacctgagtcttcagtcaaggccctccagcttg
cctgatctgtctggttcaatcgatgatctccccatggggacagaaggagctctgagtcct
ggcgtgagcacatcagggatttccagcagccaaggagagcagagcaatccagctcagtct
cccttttctcctcacacctcccctcacctgcctggcatccgaggcccgtccccgtcccct
gttggctctcctgccagtgtcgcgcagtctcgctcaggaccactctcgcctgctgcagtg
ccaggcaaccagatgccacctcggccacccagtggccagtcagacagcatcatgcaccct
tccatgaaccaatcaagcattgcccaagatcgaggttatatgcagaggaacccccagatg
ccccagtacacttcccctcagcctggctcggccttatccccacgtcagccgtctggagga
cagatgcactcgggcgtgggctcctaccagcagaactccatggggagctacggcccccag
ggcagtcagtatggcccacaaggaggctatcctaggcagcctaactataatgccttgccc
aacgccaactaccccaatgcaggcatggccggaagtatgaaccctatgggtgctggaggt
cagatgcatgggcagcctggaatcccaccttacggcacactccctccagggagaatggct
catgcgtctatgggcaacaggccctatggccctaatatggccaatatgccacctcaggtt
gggtcagggatgtgtcctccaccagggggaatgaacaggaaaactcaagagtctgctgtt
gccatgcatgttgctgccaactctatccaaaacaggccaccaggctacccaaatatgaat
caagggggcatgatgggaactggacctccctatggacaggggatcaatagtatggctggc
atgatcaaccctcagggacccccatatcctatgggtggaaccatggccaacaattcagca
gggatggcagccagcccagagatgatgggccttggggatgttaagttaactcccgccaca
aaaatgaacaacaaggcagatggaacacccaagacagaatccaaatctaagaaatccagt
tcttctaccaccaccaatgagaagatcaccaaattgtatgagttgggtggtgagcccgag
aggaagatgtgggtggaccggtacctggccttcacagaggagaaggccatgggcatgaca
aatctgcctgctgtggggaggaagcctctggacctctatcgcctctatgtgtctgtgaag
gagattggtgggttgactcaggtcaacaagaacaaaaaatggcgggaacttgcaaccaac
ctcaatgtgggtacatcaagcagtgctgccagctcactgaaaaagcagtatatccaatgt
ctctatgcctttgagtgcaagatcgagcgtggagaagaccctccccccgatatcttcgca
gctgctgactccaagaagtcccaacccaagatccagcccccctctcctgcgggatcaggg
tctatgcaggggccacaaactcctcagtcaaccagcagttctatggcagaaggaggagac
ctgaagccaccaactccagcatccacaccacatagtcaaattccccccttaccaggcatg
agcaggagcaactcagtcggaatccaggatgcctttcctgatggaagtgaccccacattc
cagaagcggaattccatgactccaaaccctgggtaccagcccagtatgaatacctctgac
atgatggggcgcatgtcctatgagccaaataaggatccttatggcagcatgaggaaagcg
ccaggaagtgatcccttcatgtcctcagggcagggccccaatggcgggatgggtgatccc
tacagccgtgctgctggccctgggctgggaagtgtggcgatgggaccacggcagcactat
ccctatggaggtccttacgacagagtgaggacggagcctggaatcgggcctgaaggaaat
atgggcactggagcccctcagccaaatctcatgccttccaccccagattcggggatgtat
tctcctagccgctaccccccgcagcagcagcagcaacagcagcaacaacatgattcctat
ggcaatcaattctctacccaaggcaccccttccagcagccccttccccagccagcagacc
acaatgtatcagcagcagcagcagaattataagaggccaatggatggcacatatggcccc
cctgccaagcggcatgaaggggagatgtacagtgtgccgtacagcgctgggcaaggccag
cctcaacagcagcagttgcctgcagctcagtcccagcctgccagccagccacaagctgcc
cagccttcccctcagcaggacgtgtacaaccagtacagcaatgcctaccctgcctccgcc
accgctgctactgatcgccgaccagcaggcggcccccagaaccaatttccattccagttt
ggccgagaccgagtctctgcacctcctggttccagtgcccagcagaacatgccaccacaa
atgatgggtggccccatacaggcatcagctgaggttgctcagcagggcaccatgtggcag
gggcgaaatgacatgacctacaattatgccaacaggcagaacacaggctctgccacccag
ggccctgcgtatcatggtgtgaaccgaacagatgaaatgctccacacagatcagagggcc
aaccatgaaggcccatggccttcccatggcacacgccagcctccgtatggtccttcagcc
cctgttccccccatgacaaggccccctccatctaactaccagcccccaccaagcatgccg
aatcacattcctcaggtatccagccccgctcccctcccccggcccatggagaaccgtact
tctcctagcaagtctccattcctgcactctgggatgaaaatgcaaaaggcgggtccaccg
gtgcctgcttcgcacatagcgcctacccctgtgcagccgcctatgattcggcgggatatc
accttcccacctggctctgtagaggccactcagcctgtgttgaagcagagaaggcggctc
acaatgaaagacattggaaccccggaggcatggcgggtaatgatgtccctcaagtccggg
ctcctggcagagagcacgtgggcgttagacaccattaacattctactgtatgatgacaac
agcattatgaccttcaacctcagccagctcccaggcttgctagagctccttgtggaatat
ttccgtagatgcctaattgaaatctttggcattttaaaggagtatgaggtaggggaccca
ggacagagaacattactagaccctgggagattcaccaaggtgtatagtccagcccataca
gaggaagaagaggaagaacaccttgatcctaaactggaggaggaagaggaagaaggggtt
ggaaatgatgaggagatggcctttttgggcaaggacaagccatcttcagagaataatgag
gagaagctagtcagtaagtttgacaagcttccggtaaagatcgtgcagaggaatgaccca
tttgtggtggactgctcagataagcttgggcgcgtgcaggagtttgacagtggcctgcta
cactggcggattggtggtggggataccactgagcatatccagacccactttgagagcaag
atagagctgctgccttcccggccttatgtgccctgcccaacgccccctcggaaacacctc
acaacagtagagggcacaccagggacaacggagcaggagggccccccgcccgatggcctt
ccagagaaaaggatcacagccaccatggatgacatgttgtctacccggtctagcacattg
actgatgagggggcaaagagtgcagaggccaccaaggaaagcagcaagtttccatttggc
attagcccagcacagagccaccggaacatcaaaattttagaggatgaaccccatagtaag
gatgagaccccactgtgtacccttctggactggcaggattcccttgctaagcgctgtgtc
tgtgtctccaataccatccggagcctgtcgtttgtgccaggcaacgactttgagatgtcc
aaacacccagggctgctgcttatcctgggcaagctgatcctgctgcaccacaagcaccca
gagcggaagcaggcaccactaacttatgagaaggaggaggaacaggaccaaggggtgagc
tgtgacaaagtggagtggtggtgggactgcttggagatgctccgagaaaacacgctggtc
accctcgccaacatctcggggcaattggacctatccccatatcctgagagcatctgcctg
cctgtcctggacggactcctacactgggcagtttgcccttcagctgaagcccaggacccc
ttctcaaccctaggccccaatgccgtcctctccccccagagattggtcttggaaaccctc
agcaaactcagcatccaggacaacaatgtggacctgatcctggccactcccccttttagc
cgcctggagaagttgtatagtaccatggtgcgcttcctcagtgaccgaaagaacccagtg
tgccgggagatggccgtggtactgctggcaaatctggcccagggggacagcctggcagcc
cgggccattgcagtgcagaagggcagcatcggcaacctcctgggtttcctggaggacagc
cttgctgccacacagttccagcagagccaggcaagcctcctgcatatgcagaatccaccc
tttgaaccaactagtgtggacatgatgcggcgggctgcccgagcactgcttgccctggcc
aaggtggatgagaaccactcagagttcactctgtatgagtcacggctgttggacatctcc
gtgtcaccactgatgaactcattggtttcacaagtcatttgtgatgtactgtttttgatt
ggccagtcatga

DBGET integrated database retrieval system