KEGG   Mus musculus (mouse): 93790
Entry
93790             CDS       T01002                                 

Symbol
Nipa2, 2600017P10Rik, 3830408P04Rik, AB041581
Name
(RefSeq) non imprinted in Prader-Willi/Angelman syndrome 2 homolog (human)
  KO
K22733  magnesium transporter
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    93790 (Nipa2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC57: NiPA-like magnesium transporter
   93790 (Nipa2)
SSDB
Motif
Pfam: Mg_trans_NIPA EamA DUF6790
Other DBs
NCBI-GeneID: 93790
NCBI-ProteinID: NP_001243059
MGI: 1913918
Ensembl: ENSMUSG00000030452
Vega: OTTMUSG00000031183
UniProt: Q9JJC8
Position
7:complement(55581014..55612241)
AA seq 359 aa
MSLGRGKYDFYIGLGLAMTSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWW
AGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSI
LGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATFVVIVALIFIFVVGPRHGQTNILV
YITICSVIGAFSVSCVKGLGIAIKELLAGKPVLQHPLAWILLFSLVVCVSTQINYLNRAL
DIFNTSIVTPIYYVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFK
DVSFSLASLPVSFRKDEKAMNGNLSSMYEVLNNNEDDLPCGIEHTGENISRRNGNLPSF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgagcctggggcgtggaaaatatgatttttatattggtctgggattggctatgacctcc
agcattttcattggagggagtttcattttgaaaaaaaaaggccttctgcgacttgccagg
aaaggctcaatgagagcaggtcaaggaggccatgcatatcttaaggaatggttgtggtgg
gctggactgctgtcaatgggagccggtgaagtggccaattttgctgcatatgcatttgct
ccggccacattagtgactccactaggtgcgctcagcgtcctcgtaagtgccattctgtct
tcatacttcctaaatgaaagacttaatcttcatgggaaaattgggtgtttgctaagtatt
ctagggtctacagttatggtcattcatgctccaaaggaagaggagattgagaccttaaat
gaaatgtcacataagttaggtgatccaggttttgtggtctttgcaacatttgtggtcatt
gtggccttgatattcatctttgtggtgggacctcgacatggacagacaaacattcttgtg
tatataacaatctgctctgtgattggagcattttcagtctcctgtgtgaagggtttgggt
atcgccataaaagagttgttggctggaaagcctgttctgcagcaccccctcgcctggatt
cttctgtttagccttgtggtctgtgtgagcacacagattaattacctaaaccgggctctg
gacattttcaacacttccattgtgactccaatatattatgtgttctttacaacttcagtt
ttgacttgttcagctattctttttaaagaatggcaggatatgcctgttgatgatgtcatt
gggactttgagtggcttcttcacaatcattgtggggatatttttgttgcatgcctttaaa
gatgtcagttttagtctagcaagtctgccagtatcttttcgaaaagatgaaaaggcaatg
aatggcaatctttctagtatgtatgaagttcttaataataatgaagacgacttaccctgt
ggaattgaacacactggtgaaaatatttcccgtaggaatggaaatctgccatctttttaa

DBGET integrated database retrieval system