KEGG   Mus musculus (house mouse): 93837
Entry
93837             CDS       T01002                                 
Symbol
Dach2, 9430028N04Rik
Name
(RefSeq) dachshund family transcription factor 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ski_Sno Macoilin DUF4778
Other DBs
NCBI-GeneID: 93837
NCBI-ProteinID: NP_291083
MGI: 1890446
Ensembl: ENSMUSG00000025592
UniProt: Q925Q8
Position
X:112207177..112746083
AA seq 634 aa
MAVSAPPVISATSSSAGVPGGLFRAEPLYSSPGEPPRLTPNMINSFMANNHNGSVLGGGI
GGGSGGSSNTNTNECRMVDMHGVKVASFLMDGQELICLPQVFDLFLKHLVGGLHTVYTKL
KRLDISPVVCTVEQVRILRGLGAIQPGVNRCKLITRKDFETLFTDCTNARRKRQMTRKQA
VNSSRPGRPPKRSLGVLQDNARLLPHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMA
MNTLQGNGSQNGTESEPDDLNSTTGGSESSWDKDKIQSPLAASGPQHGIAHAALAGQPGL
GGAPTLNPLQQNHLLSNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMAAAA
QIHSPLSRAGASVIKERIPESPSPAPSLEESHRPGSQTSSHPSSSVSSSPSQMDHHSERM
VMMPNNREELIVDQDNGQSIKKFQRDNKEEVPAQIPVMKSPLDKIQLAPGQALHPGFPGP
FIFADSLSSVETLLTNIQGLLKVALDNARIQEKQIQQEKKELRIELFREREIRENLERQL
AVELQSRSTMQKRLKKEKKAKRKLQEALEFESKRREQVEQALKQATSGDSGLRMLKDSGI
PDIEIENSGTPHDSAAMQGGNYYCLAMAQQLCSA
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggctgtctctgcacctccggtgatctctgcaacttccagcagcgccggcgtcccgggg
ggtttattccgggctgaacccctgtattcgtctccaggagagccccctcgcctaacccct
aacatgatcaacagtttcatggccaataaccataacggcagtgtcttgggtggcgggatt
ggtggtggcagcggtggcagcagcaacaccaacacaaacgagtgccggatggtcgacatg
cacggggtgaaggtagcttcattcctgatggatggccaggaactgatctgcctgccgcaa
gtctttgaccttttcctcaagcacctggtgggagggttgcacacagtgtacactaagctg
aagagactcgacatatctccggtggtgtgcactgtagagcaagttcgaatcctccgtggg
ctgggggccatccagccaggggtgaatcgttgcaagctcatcaccaggaaagactttgaa
actttgttcaccgattgcaccaacgccagaaggaagaggcaaatgacaaggaaacaagct
gttaacagttcaaggcctggcaggccccctaagcgttctttgggagtattgcaagataat
gcccgacttctgccccatgcagtcccaggcctcttatcaccaggactgatcactccaaca
ggtatcacagctgcagcgatggctgaggccatgaagctccagaagatgaagcttatggca
atgaatactcttcagggtaatggaagccaaaatgggactgagtcagagccagatgacctt
aattctacgacaggtggaagtgaatcctcctgggataaagataagatacaatctccactt
gctgcttctggacctcaacatggaattgctcatgcagcacttgctggtcagccaggcctt
ggaggtgctccgacccttaatccacttcagcagaatcacctgctaagcaatcgtctggat
ctcccatttatgatgatgcctcatcccctacttccagtcagcttacctcctgcatcagtt
gccatggcaatgaatcagatgaatcatctcaatactattgccaacatggctgctgcagcc
cagattcacagtccactctccagagctggtgcctctgttataaaggaacggatcccagag
agtccttctcctgctccctctctggaagagagtcatcgtcctgggagccagacctcctcc
cacccaagcagcagtgtgtccagctctccctcgcagatggatcatcattcagagagaatg
gttatgatgcccaacaatcgagaagagcttattgttgaccaagataatggacaaagcata
aaaaaattccagagggataataaagaagaagtaccagctcaaatcccagtcatgaagtca
cccttggataagatccagttggctcctggacaggcattgcatcctggattccctggacca
ttcatttttgcagatagtctatcttctgtggagactctgttgaccaacattcagggtcta
ctgaaagtggctttggataatgctcgtatccaggagaagcagattcagcaggaaaagaag
gaactgcgaatagagctcttcagagaaagagaaattagagaaaacctggagcgacaactt
gcagttgagcttcaaagcagaagtacaatgcaaaagcgtctgaaaaaagagaaaaaggct
aagagaaaacttcaggaagccttggaatttgaatcaaagcgccgcgagcaagtggagcaa
gcacttaaacaagctacatctggtgacagtggactgagaatgttaaaagattctggaatt
ccagatattgaaatagaaaacagtggaacgccgcatgacagtgctgctatgcaaggaggt
aactattactgtttagcaatggcacagcagttgtgttcagcctga

DBGET integrated database retrieval system