KEGG   Mus musculus (mouse): 93840
Entry
93840             CDS       T01002                                 

Gene name
Vangl2, C530001F03Rik, L, Lootl, Lp, Lpp1, Ltap, Vang1l2, lo, loop-tail, ska, ska17, ska<m17J, ska<m17Jus>, stbm, stra, strabismus
Definition
(RefSeq) VANGL planar cell polarity 2
  KO
K04510  vang-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    93840 (Vangl2)
Motif
Pfam: Strabismus
Other DBs
NCBI-GeneID: 93840
NCBI-ProteinID: NP_277044
MGI: 2135272
Ensembl: ENSMUSG00000026556
Vega: OTTMUSG00000021582
UniProt: Q91ZD4
Position
1 H3; 1 79.54 cM
AA seq 521 aa
MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGSRGDKSVTIQAPGEPLLDNESTR
GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGAILALLSF
LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV
LRALLMVLVFLLVISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR
QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK
KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV
VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI
LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL
KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggacaccgagtcccagtactcgggctattcctacaagtcgggccactcccgcagctcc
cggaagcacagggaccgccgggaccgacaccgctctaagagccgggatgggagtcgtgga
gataaatcagtgacgatccaggctccgggagaacccctgctggacaatgagtccacgagg
ggggatgagcgggatgacaactggggagaaacaacaacggtggtcacgggcacttctgag
cacagtatctcccatgatgacctcacgcgcatcgccaaggacatggaggacagtgtcccg
ttggattgttcccgccacctgggcgtggcggcaggggccattctggcgctgctctcgttc
ctcaccccgctggctttcctgctgctgcctccactgctgtggcgggaggagctggagccg
tgtgggacggcctgtgagggcctcttcatctccgtggccttcaagctgctcatcctgctg
ttgggcagctgggctctgttcttccgccggcccaaggcctcactgccccgagtcttcgtg
ttacgagctctgctcatggtgcttgtcttcctgctggttatttcctattggctcttctac
ggtgtgcgcatcttggacgcccgggagcggagctaccagggcgtggttcagtttgccgtt
tctctagtggatgctttactcttcgtgcactatctggccgtagttctgctggagctccgt
cagctccagccccagttcacactcaaggtcgtgcgatccacagatggggccagccgcttc
tacaatgtcggccatctcagcatccagcgagtggcagtgtggatcctggagaagtattac
catgacttccctgtctacaaccccgccctcctcaacctgcccaagtccgtcctggccaag
aaagtgtctggcttcaaggtgtattctctcggagaggaaaatagcaccaataactccacg
ggccaatcaagggctgtgatcgcggctgcggcacggaggcgcgacaacagccacaatgag
tactactacgaggaagccgagcatgagcgcagagtgcgcaagcgcagggccaggctcgtg
gtggctgtggaggaggccttcacgcacattaagcggctgcaggaagaggagcagaagaac
cccagggaggtgatggacccccgggaagcagcccaagcgatctttgcatccatggctcgt
gccatgcagaagtaccttcgcaccaccaaacagcagccttaccataccatggagagcatc
cttcagcacctggagttctgcattacccacgacatgacgcccaaggccttcctggagcga
tatttggctgctggacccaccatccagtaccacaaggaacgttggctggccaaacagtgg
accttggtgagcgaggagccggtgaccaatgggcttaaggatggcatcgtgttcctcttg
aagcgccaggacttcagcttggtagtgagcaccaagaaggtgcccttcttcaaactctct
gaggaatttgtggatcccaagtcacataagttcgtcatgcggctgcagtcggagacctct
gtgtga

DBGET integrated database retrieval system