KEGG   Mus musculus (house mouse): 93875
Entry
93875             CDS       T01002                                 
Symbol
Pcdhb4, Pcdhb5A, PcdhbD
Name
(RefSeq) protocadherin beta 4
  KO
K16494  protocadherin beta
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    93875 (Pcdhb4)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   93875 (Pcdhb4)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2 Cadherin_3
Other DBs
NCBI-GeneID: 93875
NCBI-ProteinID: NP_444359
MGI: 2136738
Ensembl: ENSMUSG00000045689
UniProt: Q91XZ6 Q8CE07 Q8CBE8
Position
18:37440508..37444226
AA seq 784 aa
METALAKMSQQRQVVFLTMLLLLWVSGSEAIKYSMPEETESGYLVANLAQDLGIRVGELA
AREARVHHRGNKDLLQLDAETGNLFLKEKLDREGLCGATEPCVLHFQIILKNPVQFFQTE
LQLTDINDHSPEFPDTEMLLTIPESAQPGTVFPLKAAQDPDMGSNAIQNYTVSPNLHFHV
VTLSRSDGRKYPELVLDRALDREEQPELTLILTALDGGAPRRSGMTTVHIEIMDINDNAP
QFVQSLYEVQVPENFPLDALLVTVSARDLDAGIYGNIAYSLFQGDGDSQPFVIDEITGEI
RLSKKLDFEVTPYYNVEIAATDGGGLSGKCTVAVQVLDVNDNAPELTVSTLSSPIPENSP
ETVVAVFGVFDPDSGDNGRMVCSIQNELPFLLKSTFENYYTLATERPLDRESIAEYNITI
TVSDMGTPRLTTQHTIKVQVSDINDNAPAFTQTSYTLFVHENNSPALHIGTISATDSDSG
SNAHITYSLLPPQDPQLALSSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPAL
SSQTLVRVVVLDDNDNAPFVLYPLQNASAPYTELLPRAAEPGYLVTKVVAVDRDSGQNAW
LSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDAPKHRLLLLVKDNGEPLRSASVTMHVL
VVDGFSQPYLPLPEVALDPTREEDNLTLYLVISLASVSSLFLLSVLLFMGARLCRRAREA
SLGGYSVPEGHFPGHLVDVSGAGTLSQSYQYEVCLSGDSGITDFKFLKPSNPNSLIPDNY
MLNS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggagacagcgctagcaaaaatgtcacagcaaaggcaagttgtttttcttactatgttg
ttgcttttgtgggtgtctggttcagaggcaattaaatattccatgccagaagaaacagag
agtggctacttggtggctaacctggcacaagatctggggatcagggttggggaactggca
gctagagaggcacgagtccatcacagaggaaacaaagacctcttgcagctggatgcagag
acaggaaatctgttcttgaaggaaaaattagaccgtgaggggctttgcggggcgacagaa
ccctgtgtgctgcacttccagatcatactgaaaaaccctgtgcagttctttcaaactgaa
ctgcagctcacagatataaatgaccactctccggagttccctgacacggaaatgctccta
acaatccctgagagcgcccagccaggaactgtgtttcctctgaaggcagctcaggaccct
gacatggggagcaacgctattcagaactacacagtcagtcccaacctccatttccatgtc
gttactctcagtcgctcagatggcaggaaatacccagagctggtgctggacagagccctg
gacagggaggagcagcctgagctcactttaatcctcaccgctctggatgggggagctcca
cgaaggtctgggatgaccacagttcatattgaaatcatggacatcaatgacaatgctccc
cagtttgtacaatcgctctatgaggtgcaggttcccgagaatttcccccttgatgcctta
cttgtcacggtctctgctagggatttagatgctgggatatatggcaatatagcctactct
ctgtttcaaggtgatggagactcccaaccatttgtaatagatgaaatcacaggagaaatc
cgtctaagcaaaaagttggactttgaggtaactccatactataatgtggaaatcgcagcc
acggatggagggggactttcaggaaaatgcactgtagctgttcaggtgttggatgtgaat
gataacgccccagagttgacggtctctacgctctcaagccctatccccgaaaactcccca
gagactgtcgttgcagtttttggtgtttttgacccagattctggggacaatggaaggatg
gtgtgctctattcagaacgaacttccatttcttttaaagtccacatttgagaactattat
actttagcgacagagaggccactggatagagagagtatcgctgagtacaacatcaccatc
actgtctcagacatgggcacacccaggctcacaacccagcatactataaaagtgcaggtg
tctgacatcaacgacaacgcccccgccttcacgcaaacctcctacaccctgtttgtccat
gagaacaacagccccgccctgcacataggcaccatcagtgccacagactcagactcgggc
tccaatgcccacatcacctactcgcttctgccgccccaggacccgcagctggccctctcc
tcgctcatctccatcaacgctgacaacgggcagctgtttgcgctcagggcattggattat
gaggccctgcaggccttcgagttccacgtgggcgccacagatggaggttcgcccgcgctc
agcagccagactctggtgcgcgtggtggtgctagacgacaatgacaatgcgcccttcgtg
ctctacccactgcagaatgcttctgcgccctacaccgagctgctgcccagggcagcggag
cctggctacctggtcaccaaggtggtggcagtggaccgcgactctggtcagaatgcctgg
ctgtcattccagctgctcaaggctacggagcccgggttgttcagcgtgtgggcgcacaat
ggcgaggtgcgcaccaccaggctgctgagcgagcgagatgcacccaagcacaggttgctg
ttgctggtcaaggacaatggagagcctctgcgctctgccagtgtcacaatgcacgtgcta
gtggtggatggtttctctcagccctacctgcccctgccagaggtggcgctggatcctaca
cgggaagaagataatctcacgctgtatcttgtcatctccttggcatctgtgtcttctctc
ttcctcttgtctgtgctgctgttcatgggggcgaggctgtgcaggagggccagggaggcc
tctctgggaggctactctgtgcctgagggacactttcctggccacctggtggacgtcagc
ggggcagggaccctgtcccagagctatcagtatgaggtgtgtctgagcggagactctggg
attacagattttaagttcctgaagcccagcaatcccaatagtctgattccagacaattac
atgttgaatagttaa

DBGET integrated database retrieval system