KEGG   Mus musculus (mouse): 93891
Entry
93891             CDS       T01002                                 

Symbol
Pcdhb20, Pcdhb, Pcdhb1, Pcdhb14, PcdhbT
Name
(RefSeq) protocadherin beta 20
  KO
K16494  protocadherin beta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    93891 (Pcdhb20)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   93891 (Pcdhb20)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2 Cadherin_3 REJ
Other DBs
NCBI-GeneID: 93891
NCBI-ProteinID: NP_444375
MGI: 2136758
Ensembl: ENSMUSG00000046191
Vega: OTTMUSG00000050746
UniProt: Q91XZ9
Position
18; 18 B3
AA seq 799 aa
MGRRRALILQKRQVLVFFVFLGLSQASAESLRYSVAEETEIGSFVANLAKDLGLGVAELS
SREARVVSDDNKKHLLLNLLTGDMLLNERLDREELCGSTQPCVLPFQVVLENPLQFYRAE
LHVRDINDHSPTFLDKEITIKISESTTIGATFLIENAQDLDIGSNSLQDYSISPSSYFYV
KIHDSGDGKIYPELVLDKALDHEEESELRLTLTALDGGSPPRSGTTLIVIKVLDINDNAP
EFAQSFYEVQVPEDMPIGSSITAISAKDLDMGIYGKISYSFLHASEDIRKTFEINPTSGE
VNLRSLMDFEVIQSYSVNIQATDGGGLSAKCTLSVKVLDINDNAPEVIMSSVTKAIPENA
SETLVALFSVRDQDSGDNGRILCSIQDDLPFILKPSFKNFFTLLSEKALDRERRAEYNIT
ITASDMGTPRLTTQHTIRVQVSDINDNAPAFTQTSYTMFIYENNSPALHIGTISATDKDS
GSNAHITYSLLPAQDPELALASLISINADNGQLFALRALDYEVLQAFEFQVGATDRGSPA
LSSQTLVRVVVLDDNDNAPFVLYPMQNASAPCTELLPRVAEPGYLVTKVVAVDRDSGQNA
WLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVPKHRLVLLVKDNGDPPRSASVTLHV
LVVDGFSQPYLPLPEVARDPAQEEDVLTLYLVIALASVSSLFLLSVLLFVGVRLCRRARA
ASLGGCSVPEGHFPGHLVDVTGTGTLSQNYQYEVCFTGGTGTNEFKFLRPVMPSLQLHDP
DSNMLEKENFRNSLGFNIQ
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgggaaggagaagggctctcatcctgcagaaaaggcaagtcttggttttctttgttttc
ctgggattgtctcaggcgagtgctgaatctttgcgctattctgtagcagaggaaacagaa
attggctcttttgtggctaatctggcaaaggatttaggactgggggttgcggagctgtcc
tccagggaggccagggtagtgtcagatgataataaaaagcatttactccttaatttgctg
actggagatatgctcctgaatgagcgactggatcgtgaagagctatgtggctccacccag
ccctgtgtgctgccctttcaggtggtactggaaaaccccttacagttctatcgagctgag
ctgcacgtcagagatataaatgatcactcccctacattcctagacaaggaaataactatt
aaaatatcagaaagcactactatcggagccacattcttaattgagaatgcacaagatctg
gacataggaagcaacagtcttcaggactacagcattagccccagttcttatttctatgtt
aaaattcatgacagtggcgatggaaagatatacccggagctggttctggacaaagcttta
gatcatgaggaggaatctgagcttagattgacacttacagcattagatggtgggtctcca
cccaggtctgggacaacactgattgtcataaaagtcttggacatcaacgataatgctcca
gagttcgctcagagtttctatgaggtgcaggtcccagaggacatgcctattggctccagt
attactgccatctctgctaaagatttagatatgggaatttatgggaaaatttcatattca
tttttgcatgcatcagaagatattagaaaaacctttgaaatcaacccaacatctggggaa
gtcaatttgagatcactaatggattttgaagtaatacagtcctattctgtaaatatccaa
gcaacagatggtggaggtctttctgcaaaatgcactctttcggttaaagtattagatata
aatgacaatgcaccagaagtgatcatgtcgtcggttacaaaggcaattccagaaaatgct
tcagagaccctggtcgctctattcagtgtccgagatcaagactctggagacaacggaagg
atcctttgctctattcaggatgaccttccatttattctgaaaccaagcttcaagaatttt
ttcactctactttctgaaaaagcactagacagagaaaggagagctgagtacaacatcacc
atcactgcctccgacatgggcacacccaggctcacaacccagcacaccataagagtacag
gtatctgacatcaatgacaatgccccggccttcacccaaacctcctacaccatgttcatc
tacgagaacaacagccctgccctgcacataggcaccatcagtgccacagacaaagactca
ggctccaatgcccacatcacctactcgctgctaccggctcaggacccagagctggccctc
gcctcgctcatctccattaacgctgacaacgggcagctatttgcgctcagggcgctggac
tatgaggtcctgcaggccttcgagttccaagtgggtgcgacagaccgaggctcgcccgca
ctcagcagccagactctggtgcgcgtggtagtgctggacgacaatgacaatgcgcccttc
gtgctctacccgatgcagaacgcctctgcgccttgcactgagctgctgcccagggtggca
gaacctggctacctggtcaccaaagtagtggctgtggatcgcgactctggccagaatgcc
tggctgtcgttccagctgctcaaggctacagagccagggctgttcagcgtgtgggcgcac
aatggcgaggtacgcactaccaggctgctgagcgagcgcgatgtgcccaagcacaggctg
gtactgctagtcaaggacaatggcgatcctccgcgctctgccagcgtcacgctgcacgtg
ctagtggtggatggcttctctcagccctacctgcctctgccagaggtggcgcgcgaccct
gcacaagaagaagatgtactaacactctacctggtcatagccttggcatctgtgtcttct
ctcttcctcttgtctgtgctgctgtttgtgggggtgaggctgtgcaggagggccagggct
gcctctctgggtggctgctctgtgcctgagggacactttcctggccatctggtggacgtt
actggcactggaaccctgtcccagaactaccaatatgaggtgtgtttcacaggaggtact
ggaacgaatgagttcaaattccttaggccggtcatgcccagtcttcagctccatgaccct
gattctaatatgctggaaaaggagaactttcgcaatagccttggttttaatattcaataa

DBGET integrated database retrieval system