KEGG   Mus musculus (mouse): 94044
Entry
94044             CDS       T01002                                 

Symbol
Bcl2l13, BCL-R, BCL-RAMBO, E430016C20Rik, Mi, Mil, Mil-1, Mil1
Name
(RefSeq) BCL2-like 13 (apoptosis facilitator)
  KO
K15485  Bcl-2-like protein 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    94044 (Bcl2l13)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    94044 (Bcl2l13)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 94044
NCBI-ProteinID: NP_705736
MGI: 2136959
Ensembl: ENSMUSG00000009112
Vega: OTTMUSG00000056829
UniProt: P59017
Position
6 F1; 6 57.01 cM
AA seq 434 aa
MASSTTASLGFHYETKYVVLSYLGLLSQEKQQGPSPPGVQLDVAPQSLNPEVLLKLKSEI
EEELKTLDKEVSEAFTSTGFDCHTSPVFSPANPESSIEDCLAHLGERVSQDLKEPLQKAL
QTILSQPVTYEAYRECTVETAVHASGWNKLLVPLVLLQHLLLELTRRGQEPLRMLLQFGV
MYLEEHAAEFIIQQGGWGSVFSLEPEEEEYPGIIAEDSNDIYILPSDNSGQVSPPESPTV
TTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSSGAGEKSENNSS
NSDIVHVEKEEVPEEAFPGAAAPLLTQVPTVEAPEMMRAEKTSPTPSVFVELGEEELEAV
TARPEAVERAEGAAQLSEERAGSRKKSHTGEAAAVRGAKSGLPAEGKAVLLFGGAAAVAI
LAVAVGVALALRRK
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggcgtcctctacgactgcgtctctaggatttcactatgaaacaaagtacgttgttctc
agctacttgggacttctttctcaggagaaacaacaaggtccctcacccccaggagttcaa
ctagatgtggctccccagtctctgaatccagaagttttattaaaacttaaatctgagatt
gaggaagaactgaaaaccctggacaaagaagtctctgaagccttcaccagcacaggcttt
gactgtcacacctcgcctgtgtttagccctgctaaccccgagagctccatagaagactgc
ttggcccatcttggagaaagagtgtcacaagacctgaaggagcctttgcagaaagcattg
cagacgatcctcagccagccagtgacatatgaggcatatcgtgaatgtacagtggagact
gcagtccatgccagcggatggaataagcttttggtgcctctagttttgctacaacacctg
cttttggaattgacgcgccgtggtcaagagcctttgcgtatgctgctccagttcggtgtg
atgtacctggaggagcacgccgcagagttcatcattcagcaaggtggctggggcagtgtc
tttagtcttgagcctgaggaggaggaatacccggggatcattgcggaagatagcaatgac
atttatatactgcccagtgacaactccggacaagttagtccccctgaatccccgacagtg
acaacatcctggcagtcggagagccttcccgtctcactgtctgctagccagagctggcac
acagaaagcctcccggtgtcgctcgggcccgagtcctggcagcagattgcaatggaccct
gaagaagtgaagagcttagacagcagcggggctggggagaagagtgagaacaactcgtcc
aactctgacatcgtgcacgtggagaaggaggaggtgccagaggaggccttcccgggagcg
gctgctcccttgctcacacaggtccctaccgtggaggccccagaaatgatgagagctgag
aaaacgagccccactccgtctgtgtttgtggagcttggtgaggaggagctggaagcagta
acagcgagacccgaggctgtggagagggcggagggggccgctcagctgagtgaggagaga
gccgggagcaggaaaaagagccacactggggaggccgccgctgtcaggggggcaaagagt
ggcctgcccgccgagggcaaggccgtactgctctttggtggggctgctgcggtggccatc
ctggcagtggctgttggagttgcactggctttaagaagaaagtaa

DBGET integrated database retrieval system