KEGG   Mus musculus (mouse): 94045Help
Entry
94045             CDS       T01002                                 

Gene name
P2rx5, P2X5
Definition
(RefSeq) purinergic receptor P2X, ligand-gated ion channel, 5
  KO
K05219  P2X purinoceptor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    94045 (P2rx5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    94045 (P2rx5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    94045 (P2rx5)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   94045 (P2rx5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor
Motif
Other DBs
NCBI-GeneID: 94045
NCBI-ProteinID: NP_001363911
MGI: 2137026
Ensembl: ENSMUSG00000005950
Vega: OTTMUSG00000006120
Position
11; 11 B4
AA seq 480 aa AA seqDB search
MGQAAWKGFVLSLFDYKTAKFVVAKSKKVGLLYRVLQLTILLYLLIWVFLIKKSYQDIDT
SLQSAVVTKVKGVAYTNTTMLGERLWDVADFVIPSQGENVFFVVTNLIVTPNQRQGICAE
REGIPDGECSEDTDCHAGESVVAGHGLKTGRCLRVGNSTRGTCEIFAWCPVETKSMPTDP
LLKDAEGFTIFIKNFIRFPKFNFSKANVLETGNKHFLKTCHFSSTNLYCPIFRLGSIVRW
AGADFQDIALKGGVIGIHIEWDCDLDKAASHCNPHYYFNRLDNKHTQSISSGYNFRFARY
YRDPHGVEFRDLMKAYGIRFDVIVNGKAGKFSIIPTVINIGSGLALMGAGAFFCDLVLIY
LIRKSEFYRDKKFEKVRGQKEEDNVEVEANEMEQELPEDKPLERVHQDEQALELAQSGRK
QNSNCQVLFEPAREKRQAMPARVPDCLLSASVCIPPSRSGLQENAFVNMKPSQILQTVKT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggccaggcggcctggaaggggttcgtgttgtctctgttcgactacaagacagcaaag
ttcgtggtcgccaagagcaagaaggtggggctgctctaccgggtgctgcagctcaccatc
ctgttgtacttactcatatgggtgtttctgataaagaagagttatcaggacattgacact
tccctgcagagtgctgtggtcaccaaagtcaagggggtggcctataccaacaccacgatg
cttggggaacgactctgggatgtggcagactttgtcattccgtctcagggggagaacgtt
ttcttcgtggtcaccaacctgatcgtgactcctaaccagcggcagggcatctgtgctgag
cgtgaaggcatcccggatggcgagtgttcagaggacaccgactgtcacgctggggagtct
gttgtagcgggacacggactgaaaactggtcgctgtctacgggtggggaactctacccgg
ggcacctgtgagatctttgcttggtgcccagtggagacaaagtccatgccaacggatccc
ctcctgaaggacgcagaaggcttcaccattttcataaagaacttcattcgcttccccaag
ttcaacttctccaaagccaatgtgctagaaacaggcaacaaacatttcctgaaaacctgt
cacttcagctccaccaatctctactgccccatcttccgactggggtccattgttcgctgg
gcaggggctgacttccaggacatagccctgaagggcggtgtgataggaatccacattgaa
tgggactgtgaccttgataaagctgcctcccactgcaacccacactattatttcaaccgt
ctggacaacaaacacacacaatccatctcctctgggtataacttcaggtttgccaggtat
taccgtgaccctcatggggtagagttccgtgacctgatgaaagcatatggcatccgcttt
gatgtgatagttaatggcaaggcgggaaaattcagcatcatccccacagtcatcaacatt
ggttccgggctggcgctcatgggtgctggggctttcttctgtgacctggtacttatctac
ctcatcagaaagagcgagttttaccgagacaagaagtttgagaaggtgaggggtcagaag
gaggaagataatgttgaggttgaggccaacgagatggagcaggagctgccagaggacaag
ccactggagagggttcatcaggacgagcaggccctggaactggcccagagtggcaggaag
cagaatagcaactgccaggtgctcttcgagcctgccagagaaaagcgacaggccatgcct
gccagagttcctgactgccttctctctgcctctgtgtgcatccctccctcaaggtctggc
ctccaggagaatgccttcgtgaacatgaagccatcacagatcttgcaaacagtgaagacg
tag

DBGET integrated database retrieval system