KEGG   Mus musculus (mouse): 94088
Entry
94088             CDS       T01002                                 

Gene name
Trim6, C430046K18Rik, D7Ertd684, D7Ertd684e
Definition
(RefSeq) tripartite motif-containing 6
  KO
K11999  tripartite motif-containing protein 6/22/34
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    94088 (Trim6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    94088 (Trim6)
SSDB
Motif
Pfam: zf-C3HC4_4 SPRY zf-RING_UBOX zf-B_box zf-C3HC4 zf-RING_2 zf-C3HC4_2 PRY zf-C3HC4_3 zf-RING_5 zf-RING_6 zf-RING_10 FAM76 zf-Nse U-box Baculo_IE-1 Fib_alpha Gp58
Other DBs
NCBI-GeneID: 94088
NCBI-ProteinID: NP_001013637
MGI: 2137352
Ensembl: ENSMUSG00000072244
Vega: OTTMUSG00000019051
UniProt: Q8BGE7
Position
7 E3; 7 55.55 cM
AA seq 488 aa
MTSTVLVDIRDEVTCPICLELLTEPLSIDCGHSFCQVCIIGNSNNSVFGQGGRSSCPVCR
TSYQPGNLRPNRHLAAIVKRLREVALCPGKQLEVIFCALHGEKLQLFCKEDGKLICWLCE
RSQEHRGHHTFLMEEVAQEYQDMFQESLKKLRREQQEAEKLKALIQEKRESWKSQVEPEK
RRIQTEFKQLRSILDREEQRELKKLEVEERKGLSIIEKAEGDLIHQSQSLKDLISDLEHR
CQGSTVELLQDVGDVTKRSEFWTLRKPQALPTKLKSLFRAPDLRKMLKVFRELTDVQSYW
VDVTLNPQTANLNLVLSKNRRQVRFVGAQLSEPSSLEEHYDCSVLGSQHFSSGKYYWEVD
VSKKTAWILGVCSTPVDPMFSFSQYSSKQGAYSRYQPQCGYWVIGLQCKHEYRAYEDSSP
SLLLSMTVPPRRIGIFLDCEAGTVSFYNVTNHGLPIYTFSKYYFPSALCPYFNPCSCIVP
MTLRRPTS
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgacttcaacagtcttggtggacatccgagatgaagtaacctgccctatctgcttggag
ctcctgacagaacccctgagcattgattgtggccatagcttctgccaggtctgcatcata
ggaaacagtaataattcagtgttcggccaaggagggaggagcagctgtcctgtgtgccgg
acctcctatcagcctgggaacctccgtcctaatcggcacctggccgccatagtgaagagg
ctcagagaggttgcgttgtgccctggaaaacaactcgaggtcattttttgtgcgcttcat
ggagagaaactccagctcttttgcaaggaggatgggaagttaatttgctggctttgtgaa
cgatctcaggagcaccgtggtcatcacacattcctcatggaggaggtggcccaggagtac
caggacatgttccaggagtctctgaagaaattgaggagggagcagcaggaagccgagaag
ctaaaagctcttatccaggagaagagggaatcctggaagagtcaggtggagcctgagaaa
cgccggatccagacagagtttaagcagctccgaagcatcctggacagggaggagcagcgg
gaactgaagaaactggaagtggaagagaggaaggggctgagcatcatagaaaaggccgag
ggtgacctgatccaccagagccagtcactgaaggacctcatctcagacctggagcaccgg
tgccaggggtccaccgtagaactgctgcaggatgtgggtgatgttacaaaaaggagtgag
ttctggaccctgaggaagccccaagctctccccaccaagctgaaaagtttgtttcgagca
ccggatctgaggaagatgctaaaagtctttagagagctgacagatgtccaaagctattgg
gtggacgtgacactgaatccacagacggctaatttaaatcttgtcctgtcgaaaaatcgg
agacaggtgaggtttgtgggtgcccagctgtccgagccatccagtctggaagaacattat
gactgtagtgtcctgggctctcagcacttctcctcaggaaaatactactgggaagtggac
gtgagcaagaagacggcatggatcttgggtgtatgcagtaccccggtggatcccatgttc
tctttcagccagtactccagcaagcagggcgcctactccaggtatcagccacagtgtgga
tactgggtgattggcttgcagtgtaagcacgagtacagagcctatgaggattcctccccg
tccctgctcctctccatgaccgtgccacctcgacgcatagggattttcttagactgtgag
gctggcacggtctccttttataatgtcacaaaccacggcttgcccatctacaccttctcg
aagtattactttccttctgccctttgtccctattttaatccctgcagctgtatagtcccg
atgaccctgcggcggccaacttcctga

DBGET integrated database retrieval system