KEGG   Mus musculus (house mouse): 94092
Entry
94092             CDS       T01002                                 
Symbol
Trim16, 9130006M08Rik, EBBP
Name
(RefSeq) tripartite motif-containing 16
  KO
K12006  tripartite motif-containing protein 16
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    94092 (Trim16)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    94092 (Trim16)
SSDB
Motif
Pfam: PRY SPRY zf-B_box
Other DBs
NCBI-GeneID: 94092
NCBI-ProteinID: NP_444399
MGI: 2137356
Ensembl: ENSMUSG00000047821
UniProt: Q99PP9 Q5SVT2
Position
11:62711034..62733774
AA seq 556 aa
MAELDLIAPGPLTGVTAHPLAPLGPDPVSAIPAEKEDADPLSKSGEETQEQGHDPAEVGA
PGEEDQILCDFCLGASRVRAVKSCLTCMVNYCEEHLRPHQENSKLHSHQLTEPAKDQDLR
TCPAHHSPLVSFCHTHQQCICQECGEGEHRGDSTVSLDAARRNKEVDLRCMQLDLEQKLK
LNENAIARLQANHKSVLVSVSEVKVVAEEKFGELLAAVRKAQADVMVFLEEKEQAALNQV
NSIKTHLEHRSLEMEKSKQELERLAAISNTVLFLEEYCKLKKTEDTASPSIYIGLKDKLS
GIRKVITDSTLNLIQLLESYKEKLQEFSREEEYDIRTQVSAIVQRKYRTSKPEPRTRDEF
LQYACDITFDPDTAHRYLRLQEDNRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHR
YYFEVELSGGGTYVGLTCKGIDRKGEERNSCISGNSFSWSIHWNGKEFTAWHSDTETPLK
VSPFRRLGIYVNFPGGILSFYGVEYDAMTLIHKFDCKFSEPVYAAFWLSKKENAIRIVDL
GEEPEKPAGSSVEAAP
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggctgaattggatctgattgccccggggcctctgaccggggtcactgctcaccctttg
gcccctctcggcccagaccctgtgtcagctatcccagcagaaaaagaagatgcggaccct
ctcagcaagtcaggtgaggaaacccaggagcagggtcatgaccccgcagaggtcggggct
cctggtgaagaggatcagatcttgtgtgacttctgtcttggggccagcagagtaagggca
gtgaaatcctgtctgacctgcatggtgaactactgtgaggagcacctgcggccacaccag
gagaacagcaaactgcacagccaccagctaaccgaacccgcaaaggaccaggatctacgc
acctgccctgcccaccacagccctttggtttccttctgccacacgcaccagcagtgtatc
tgccaggaatgcggggagggtgaacacagaggcgacagtactgtctccctggatgcagcc
cgcaggaacaaagaggtggaccttcggtgtatgcagttggacctggagcagaagcttaag
ttgaatgaaaatgccattgccaggctccaagctaaccataagtctgttttggtgtcggtg
tcagaggtgaaggtggtagctgaagagaagtttggggaactcctcgcagctgtacggaag
gcccaggcagatgtgatggtcttcctagaggagaaagaacaggctgcactgaatcaagtc
aacagcatcaaaacccatctggagcacaggagcctcgagatggagaaaagcaagcaggag
ctggagaggctggccgccatcagcaacactgtgctgttcctggaggagtactgcaagctc
aagaagacagaggacactgcctcccctagcatttacatagggctgaaggacaaactctca
ggcatccgcaaggtcatcacagattcaactctgaacttgatccaattgctagaaagctat
aaggaaaagctccaggaattttccagggaagaggaatatgacatcagaactcaagtgtct
gccattgtccagcgcaagtataggacctcgaaacctgagcccagaacccgggatgagttt
cttcaatatgcctgtgacatcacgtttgacccagacacagcacacaggtaccttcgcctg
caggaggacaaccgcaaggtcaccaacaccacgccctgggaacacccctacccggacctc
cccagtaggtttctgcactggcggcaggtgctgtcccaacagagcctgtacctgcacaga
tattattttgaggtggagctctctggaggtggcacctatgttggcctgacctgcaaaggc
attgaccgtaagggggaagaacggaacagctgcatttctggaaatagcttctcctggagc
atccattggaatgggaaggagttcacagcctggcacagtgacacagagaccccgctcaag
gtcagccccttcagaaggctcggtatctatgtaaacttcccaggaggaatcctttccttc
tatggtgtagagtatgatgctatgactctgattcacaagtttgactgcaagttctcagag
ccggtctatgctgctttctggctgtctaagaaagaaaacgccatccggattgtggatctg
ggagaggagcccgagaagccagctgggtcctctgtggaggctgctccctag

DBGET integrated database retrieval system