KEGG   Mus musculus (mouse): 94178Help
Entry
94178             CDS       T01002                                 

Gene name
Mcoln1, 2210015I05Rik, TRPML1, mucolipidin
Definition
(RefSeq) mucolipin 1
  KO
K04992  mucolipin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    94178 (Mcoln1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   94178 (Mcoln1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel Ion_trans DUF1866
Motif
Other DBs
NCBI-GeneID: 94178
NCBI-ProteinID: NP_444407
MGI: 1890498
Ensembl: ENSMUSG00000004567
Vega: OTTMUSG00000026357
UniProt: Q99J21
Structure
PDB: 

Position
8 A1.1; 8 1.92 cM
AA seq 580 aa AA seqDB search
MATPAGRRASETERLLTPNPGYGTQVGTSPAPTTPTEEEDLRRRLKYFFMSPCDKFRAKG
RKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDGSDDTFAAY
TQEQLYQAIFYAVDQYLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPAND
TFDIDPRVVTDCIQVDPPDRPPDIPSEDLDFLDGSASYKNLTLKFHKLINVTIHFQLKTI
NLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETKTHIQECKHPSVSRHGDNSFRLL
FDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFMWRRRGREISLWERLEFVNGWYILLVT
SDVLTISGTVMKIGIEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRV
ALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM
QAQQGHSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGTGTEKSELQAY
IEQCQDSPTSGKFRRGSGSACSLFCCCGRDSPEDHSLLVN
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccggcgggccggcgcgcctcagagactgagcggctgctgacccccaatcct
gggtatgggacccaggtggggacctcaccagccccaacaacccccacagaagaggaagac
ctccgccgccgcctcaagtacttctttatgagcccatgtgacaagttccgggccaaaggc
cgcaagccctgcaagctgatgctgcaggtggtcaagatcttggtggtcactgtgcagctc
attctctttgggctcagcaaccagctggtggtgacattccgggaagagaacaccattgcc
ttccgacatctcttcctgctgggttactctgatgggtctgatgacacctttgcagcctac
acacaggagcagctctaccaagccatcttctatgctgtggaccagtacctgatactacct
gagatatccctgggccggtatgcctatgtccgtggtgggggtgggccttgggccaatgga
tcagctttggctctctgccagcggtactaccaccgtggccatgtggacccagccaatgat
acctttgacattgatccaagggtagtcactgactgtatccaggtggatcctcctgacaga
ccccctgacatccccagtgaggacttggacttcttggatggcagcgccagttacaagaac
ctcacactgaaattccacaagctgatcaacgtcaccatccacttccagctgaagacaatt
aacctgcagagcctcatcaacaatgagatccctgattgttacaccttcagtatcctgatc
acatttgacaataaagcgcacagtgggcgaatccccatccgcctggagaccaagacccac
atccaggagtgcaaacaccccagtgtctccagacatggagacaacagcttccggcttctg
tttgatgtggtggttatcctcacctgctccctgtccttcctgctgtgcgcccgctcactg
ctccgtggcttcctgctgcagaacgagtttgttgtattcatgtggcggcggcggggtcgg
gaaatcagcctctgggaacggctggagtttgtcaatggctggtacatcctgctggtcacc
agtgacgtgctcaccatctcggggactgtcatgaagattggcattgaggcaaagaaccta
gccagctatgatgtctgcagtattctcttgggtacctccactctgctagtctgggtcggt
gtcattcgctacctgacatttttccacaagtacaacatcttgattgccacgttgcgagtg
gcactgcccagtgtcatgcgtttctgctgctgtgtggctgtcatctacctgggctattgc
ttctgtggctggatcgttctagggccctaccatgtgaagttccgctcgctgtccatggtt
tctgagtgtctgttctcactcatcaacggagacgacatgtttgtgacgttcgcggccatg
caggcccagcagggtcacagcagcctggtgtggctcttctcccagctgtacctctactcc
ttcatcagcctcttcatctacatggtgctgagcctcttcattgcactcatcaccggcgcc
tatgacaccatcaagcacccaggaggtactggcacagagaagagtgagctccaggcctac
atcgagcagtgccaggatagccccacatctggcaagttccgtcgtggcagtggctcagct
tgtagccttttctgctgctgtggaagggactccccggaggaccattcgctgctggtgaac
tga

DBGET integrated database retrieval system