KEGG   Mus musculus (mouse): 94185Help
Entry
94185             CDS       T01002                                 

Gene name
Tnfrsf21, AA959878, DR6, R74815, TR7
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 21
  KO
K05157  tumor necrosis factor receptor superfamily member 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    94185 (Tnfrsf21)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   94185 (Tnfrsf21)
CD molecules [BR:mmu04090]
 Proteins
  94185 (Tnfrsf21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death Ephrin_rec_like CARD
Motif
Other DBs
NCBI-GeneID: 94185
NCBI-ProteinID: NP_848704
MGI: 2151075
Ensembl: ENSMUSG00000023915
UniProt: Q9EPU5
Structure
PDB: 

Position
17; 17 B3
AA seq 655 aa AA seqDB search
MGTRASSITALASCSRTAGQVGATMVAGSLLLLGFLSTITAQPEQKTLSLPGTYRHVDRT
TGQVLTCDKCPAGTYVSEHCTNMSLRVCSSCPAGTFTRHENGIERCHDCSQPCPWPMIER
LPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVP
SSVMKCKAHTDCLGQNLEVVKPGTKETDNVCGMRLFFSSTNPPSSGTVTFSHPEHMESHD
VPSSTYEPQGMNSTDSNSTASVRTKVPSGIEEGTVPDNTSSTSGKEGTNRTLPNPPQVTH
QQAPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNAHKHFDINEHLPWMIVLFLLL
VLVLIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSLTPTQNREKWIYYRNGHGIDILK
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLIS
ALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPMPSPNVKLENSTLLTVEP
SPLDKNKCFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHILNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggggacccgggcaagcagcatcaccgccctcgcctcttgcagccgcaccgccggccaa
gtcggagccacgatggtcgccggctctcttctcctgcttggattcctcagcaccatcaca
gctcaaccagaacaaaagactctgagtctccctggcacctaccgccatgttgaccgtacc
actggccaggtgctaacctgcgacaagtgcccagcaggaacgtacgtctccgagcactgt
accaacatgagcctgcgagtctgcagcagctgccccgcggggacctttaccaggcacgag
aacggcatagagagatgccatgactgtagtcagccatgtccatggccgatgattgagaga
ttaccttgtgctgccttgactgaccgagagtgcatctgcccacctggaatgtatcagtct
aatggtacctgcgctccccatacagtgtgccccgtgggctggggtgtgcggaagaaaggg
acagagaatgaagatgtgcgctgtaagcagtgcgctcggggtaccttctctgacgtgcct
tccagtgtgatgaagtgtaaagctcacacggactgtctgggtcagaacctggaggtggtc
aagccagggaccaaggagacagacaacgtctgtggcatgcgcctgttcttctccagcaca
aacccaccttcctctggcacagttaccttttctcaccctgagcatatggaatcccacgat
gtcccttcctccacctatgagccccaaggcatgaactcaacagattccaactctactgcc
tctgttagaactaaggtaccaagtggcatcgaggaagggacagtgcctgacaatacgagc
tcaaccagtgggaaggaaggcactaataggaccctgccaaacccaccacaagttacccac
cagcaagccccccaccacagacacattctgaagctgctgccatcgtccatggaggccacg
ggtgagaagtccagcacagccatcaaggcccccaagaggggtcaccccagacagaacgct
cacaagcatttcgacatcaacgagcacttgccttggatgatcgtcctcttccttctgctg
gtcctggtgctgatagtggtgtgcagtatccgaaagagctccaggactctcaaaaagggg
ccccggcaggatcccagcgccatagtggaaaaggcggggctgaagaagtccctgactccc
acccagaaccgggagaaatggatctactaccgcaacggccatggtattgacatcttgaag
cttgtagcagcccaggtgggaagccagtggaaggacatctatcagtttctttgcaacgcc
agcgagagggaggtggcggccttctccaatggatacactgcagatcatgaacgggcctac
gcggctctgcagcactggaccatccgtggccctgaggccagccttgcccagctcattagc
gccttgcgccagcaccgacgcaatgatgttgtggagaagattcgtgggctgatggaagac
accacgcagttggaaacagacaaactggctctccccatgagccccagtccgcttagcccg
agccccatgcccagtcctaacgtgaaacttgagaattccactctcctgacagtggagccc
tcaccgctggacaagaacaagtgcttcttcgtggacgagtcagagccccttctgcgatgc
gactccacatccagtggctcttcagcactgagcagaaacggctcctttattaccaaagaa
aagaaggacacagtgttgcggcaggtccgcctggacccctgtgacttgcagcccatcttt
gatgacatgctgcatatcctgaaccccgaggagctgcgggtgattgaagagattccccag
gctgaggacaaactggaccgcctcttcgagatcattggggtcaagagccaagaagccagc
cagaccctcttggactctgtgtacagtcatcttcctgacctattgtag

DBGET integrated database retrieval system