KEGG   Mus musculus (house mouse): 94190
Entry
94190             CDS       T01002                                 
Symbol
Ophn1, C130037N19Rik, Wtgr
Name
(RefSeq) oligophrenin 1
  KO
K20650  oligophrenin-1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    94190 (Ophn1)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    94190 (Ophn1)
SSDB
Motif
Pfam: BAR_3 RhoGAP PH Arfaptin Patched
Other DBs
NCBI-GeneID: 94190
NCBI-ProteinID: NP_001300683
MGI: 2151070
Ensembl: ENSMUSG00000031214
UniProt: Q99J31
Position
X:complement(97597886..97934691)
AA seq 802 aa
MGHPPLEFSDCYLDSPDFRQRLKYYEEELERTNKFIKDVIKDGSALISAMRNYSSAVQKF
SQTLQSFQFDFIGDTLTDDEINIAESFKEFAELLNEVENERMMMVQNASDLLIKPLETFR
KEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLLEADLQVDKERHNFFESSLD
YVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLPYKQQLQLSLQNTRNHFS
STREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWAKYYCRYEKETRMLTM
IPMEQKPGAKQGPVDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQAPSEANRRLWM
EAMDGKEPIYHTPITKQEEMELNEVGFKFVRKCINFIETKGIKTEGLYRTVGSNIQVQKL
LYAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYKLHKELVSAAKSDNLDY
RLGAIHSLVYKLPEKNREMLELLIKHLVNVCEHSKENLMTPSNMGVIFGPTLMRAQEDTV
AAMMNIKFQNIVVEILIEHFGKIYLGPPEDSQVPPVPPPRVTARRHKPITISKRLLREKT
VFYTSSLDENKDESHHQTPNGTITSNLDPPKLLQHLKPPMQKSGETDPGRKSPSRPVSDC
QSEPCLETDVGRLLFRLQDGGTKATPKASNGPVPGSGHTKTSSFHIRRPAPRPMAHHKEG
DTDGFSKVRPPGEKQTIIRPPVRPPDPPCRSITPQKPEPKPETGSGNADEIPSSVVASRT
RFFETASRKTGSSQGKLPGDES
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggggcatcccccgctggagttcagcgactgctacctcgacagccccgatttccgccag
aggctcaagtattatgaagaggagctggagaggaccaataaattcatcaaagacgtgatc
aaagacggcagcgcgcttatcagcgctatgagaaattactcttctgcggttcagaaattt
tctcagacactccagtcatttcaatttgatttcattggagacacgctgaccgatgatgag
attaatatagcggaatcattcaaggaatttgctgaattgctcaatgaagtagaaaatgaa
aggatgatgatggtacaaaatgctagtgacttgctgatcaaacccctggaaacttttcgg
aaggaacaaataggttttacaaaggaaaggaagaagaaatttgaaaaggatggtgagagg
ttttactcgctactggaccgccacttacatctgtcatccaaaaagaaagaatctcagcta
ctagaggcagacctccaagtggataaggaaaggcacaatttctttgaatcatctcttgac
tatgtttatcaaattcaggaagtccaggagtcaaagaagttcaatattgtggagccggtc
ttggccttccttcatagcctcttcatttctaacagcttgactgtggagctcacacaggat
ttcctgccatacaaacaacagctgcagctcagcttacagaatacaagaaatcatttctcc
agtacccgggaggagatggaagaacttaagaaaaggatgaaagaagcccctcagacatgc
aaacttccaggacagccaaccattgaaggctatctctacacacaggagaaatgggccctg
gggatatcctgggcgaaatactattgtcggtatgagaaagagaccaggatgctcacaatg
ataccaatggaacagaagccaggtgctaagcagggaccggtggacttaactttgaagtac
tgcgtgagaaggaagacagagtcaattgacaagagattctgttttgatatagaaactaat
gaaagacctggaaccatcactctgcaggcgccttccgaagccaatagaaggctatggatg
gaagccatggatggcaaagaacctatctaccacactcctataacaaaacaggaagaaatg
gagctgaatgaagtggggttcaaatttgttaggaagtgcatcaattttattgagaccaaa
gggatcaagacagaagggctgtaccgcaccgtgggcagcaacatccaggttcagaagctg
ctctatgccttttttgatccaaaatgtccaggggatgttgatttccataacagtgactgg
gacattaagacaatcacaagctctttaaaattctacctcaggaatctctcagaacctgtc
atgacttataagctccataaagaactcgtctctgctgccaaatctgacaacctggattac
cgtctgggggctattcactccctagtatataagctaccagaaaagaaccgggagatgctg
gaacttctaatcaaacacttggtaaatgtgtgtgagcacagcaaagagaatcttatgaca
ccttccaatatgggggtgatctttgggcccaccctgatgagagctcaagaggacactgtg
gctgctatgatgaacatcaaattccagaacattgtggtagaaatcctgattgaacacttt
ggcaagatttatttaggtccacccgaagatagccaagtacctccagtgcctccacctcga
gtgacagcaagaagacacaaaccaatcacaatctcaaagcgcttgctgagagaaaagact
gtgttctatacttcttccctggatgaaaataaagatgaaagtcaccatcaaactcctaat
ggtacaatcactagcaacctggatccccccaagctactgcagcacctcaaaccacccatg
caaaaaagtggggaaactgaccctggaagaaagtccccaagcagacctgtttctgactgt
caatcggagccctgcctagagacggatgtggggaggttgttatttaggttgcaggatgga
gggaccaaggctactccaaaggcttccaatggacctgttccaggctctggacacacaaag
acctcctctttccatataaggagaccagctcccaggccaatggctcaccacaaggaaggc
gatactgacggtttcagcaaagtccggcccccaggagaaaagcaaacaatcatccgtcct
ccggtgaggcccccagaccctccttgccggtccatcactccacaaaagccagagccaaag
ccagaaacagggtctggcaatgcagacgaaatcccatcatccgtggtggcatctaggacc
agattctttgaaacagcttcccggaaaactggaagttctcaaggaaaacttcctggagat
gagagttga

DBGET integrated database retrieval system