KEGG   Mus musculus (mouse): 94212Help
Entry
94212             CDS       T01002                                 

Gene name
Pag1, Cbp, F730007C19Rik, Pag
Definition
(RefSeq) phosphoprotein associated with glycosphingolipid microdomains 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PAG Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 94212
NCBI-ProteinID: NP_001181960
MGI: 2443160
Ensembl: ENSMUSG00000027508
Vega: OTTMUSG00000033869
UniProt: Q3U1F9 A6H659
Position
3; 3 A1
AA seq 429 aa AA seqDB search
MGPAGSVLSSGQMQMQMVLWGSLAAVAMFFLITFLVLLCSTCDREKKPRQHSGDHENLMN
VPSDKDMFSHSATSLTTDALASSEQNGVLTNGDILSEDSTLTCMQHYEEVQTSASDLLDS
QDSTGKAKCHQSRELPRIPPENAVDEILTARAADTELGPGVEGPYEVLKDSSSQENMVED
CLYETVKEIKEVADKGQGGKSKSTSALKELQGAPMEGKADFAEYASVDRNKKCRHSANAE
SILGTCSDLDEESPPPVPVKLLDENANLPQEGGGQAEEQAAEGTGGHSKRFSSLSYKSRE
EDPTLTEEEISAMYSSVNKPGQSAHKPGPCMKGPESACHSMKGLPQRSSSSCNDLYATVK
DFEKTPNSISTLPPARRPSEEPEPDYEAIQTLNREDEKVPLETNGHHVPKESDYESIGDL
QQCRDVTRL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgggccctgcaggaagcgtactgagcagtgggcagatgcagatgcagatggtcctgtgg
ggaagtctggctgccgtggccatgttcttcctcatcaccttcctcgtcctcctgtgttcc
acttgcgacagagagaagaagccacggcagcatagcggggaccatgagaacctgatgaat
gtgccttccgacaaggacatgttcagccattcggcaaccagcctgacaacagatgcactg
gctagcagcgaacagaacggggtgctcaccaatggcgacattctttcagaagacagcacg
ctgacctgcatgcagcactatgaggaagtccagacctcggcttccgatctcctggactcc
caggacagcacaggaaaggccaagtgccaccagagccgggagctgcccaggatcccgcct
gagaacgccgtggacgagattctcacagccagggctgcagacacggaactggggcccgga
gtggaggggccctacgaggtgctcaaggacagctcctcccaggagaacatggtggaggac
tgtctgtatgaaacagtgaaggagatcaaggaagtggcagacaaaggccagggtggcaag
tccaagtccacttctgccttgaaggagcttcagggggctcccatggagggcaaggccgac
tttgctgaatatgcctctgtggacagaaacaaaaagtgccgccacagcgcgaacgcagag
agcattctgggaacttgcagtgacctggacgaggaaagcccacctcctgtcccggttaag
cttctggatgagaatgccaaccttccccaggagggaggaggacaggcagaggagcaagct
gcagaagggaccggtggacacagcaagagatttagttccttgtcatacaagtctcgggaa
gaagacccgactcttacagaagaggagatctcagcaatgtattcctcagtgaataagcct
ggccagtcggcacacaaacctggaccatgtatgaaagggccagaatctgcctgccactcc
atgaagggcctccctcagaggtcgtcatcttcctgcaatgacctctatgccactgtgaaa
gactttgagaaaactcccaacagcatcagcacactgcccccggcaaggagacccagtgag
gagccagagcctgactatgaagccatacagactctaaacagagaggatgagaaggtccct
ctggagaccaatggccaccatgtccccaaggagagtgactacgagagcattggggacttg
cagcaatgcagagatgtcaccaggctctag

DBGET integrated database retrieval system