KEGG   Mus musculus (mouse): 94217
Entry
94217             CDS       T01002                                 

Symbol
Lrp1b, 9630004P12Rik, LRP-DIT
Name
(RefSeq) low density lipoprotein-related protein 1B
  KO
K20049  low-density lipoprotein receptor-related protein 1B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    94217 (Lrp1b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    94217 (Lrp1b)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 SGL cEGF EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 94217
NCBI-ProteinID: NP_443737
MGI: 2151136
Ensembl: ENSMUSG00000049252
Vega: OTTMUSG00000012311
UniProt: A2API5
Position
2; 2 B
AA seq 4599 aa
MSQLLLAILTLSGLLPNAEVLIVGANQDQHLCDPGEFLCHDHVTCVSQSWLCDGDPDCPD
QSDESLDTCPEEVEIKCPLNHIACHGSSACVHLSKLCNGVVDCPDGFDEGGHCQELLPSC
QQLNCQFKCAMVRNATRCYCEDGFEVAEDGRSCKDQDECSIYGICSQTCKNTYGSYACSC
VEGYIMQSDNRSCKVKHEPTDKAPMLLISSLETIELFYINGSKMTTLSSANRNEIHTLDF
IYSEEMICWIESRESSNQLKCGQITKAGRLTDQRIINSLQSFQNVEQMAFDWLTRNIYFV
DHVSDRIFVCNFNGSVCVTLIESELHNPKAIAADPIAGKLFFTDYGNVPKIERCDLDGMN
RTRIVYSKAEQPSALALDLVNRLVYWVDLYLDYVGVVDYQGKNRHTIVQGRQVKHLYGIT
VFEDYLYATSSDNFNIIRINRFNGTDIHSIIKMESARGIRTYQKRTQPTVRSHACEVDAY
GMPGGCSHICLLSSSYKTRTCRCRTGFNMGSDGRSCKRPKNELFLFYGKGRPGIVRGMDL
NTKIADECMIPIENLVNPRALDFHAEANYIYFADTTSFLIGRQKIDGTERETILKDDLDN
VEGIAVDWIGNNLYWTNDGHRKTINVARLEKASQSRKTLLEGGMSHPRAIVVDPVNGWMY
WTDWKEDKIDDSVGRIEKAWMDGVNRQVFVTSKMLWPNGLTLDFHTSTLYWCDAYYDHIE
KVFLNGTHRKVVYSGKELNHPFGLSHHGNYVFWTDYMNGSIFQLDLMTNEVTLLRHERAP
LFGLQIYDPRKQQGDNMCRINNGGCGTLCLAIPAGRVCACADNQLLDENGTTCTFNPEEI
RFHICKPGEFRCKNKHCIQARWKCDGDDDCLDGSDEDSVTCFNHSCPDDQFKCQNNRCIP
KRWLCDGANDCGSNEDESNQTCTARTCQADQFSCGNGRCIPTAWLCDREDDCGDQTDEVA
SCEFPTCEPLTQFICKSGRCISNKWHCDTDDDCGDRSDEVGCVHSCLDDQFRCSSGRCIP
GHWACDGDNDCGDFSDETHINCTKEEARSPAGCIGNEFQCRPDGNCIPDLWRCDGEKDCE
DGSDEKGCNGTIRLCDHKTKFSCRSTGRCINNAWVCDGDVDCEDQSDEEDCDSFLCGPPK
YPCANDTSVCLQPEKLCNGRKDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGRGIVCSCP
EGHQLKKDNRTCEIVDYCASHLRCSQVCEQQKHMVKCSCYEGWALGTDGESCTSVDSFEA
FIIFSIRHEIRRIDLHKGDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSES
GGVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVSKLDGSLRATLIAGAMEHP
RAIALDPRYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFERRIV
WTDARSDAIYSAFYDGTNMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLAKANKWTG
QNVSVIQKTSAQPFDLQIYHPSRQPQAPNPCAANEGRGPCSHLCLINHNRSAACACPHLM
KLSSDKKTCYEMKKFLLYARRSEIRGVDIDNPYVNFITAFTVPDIDDVAVIDFDASEERL
YWTDIKTQTITRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQINVARL
DGSLKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGLSI
DYVENKLYWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQL
GTCNKRDGRNPSILRNKTSGVVHMKVYDKEAQQGSNSCQVNNGGCSQLCLPTSETTRTCM
CTVGYYLQKNRMSCQGIESFLMYSVHEGIRGIPLEPRDKVDALMPISGAAFAVGIDFHAE
NDTIYWTDMGLNKISRAKRDQTWKEDVVTNGLGRVEGIAVDWIAGNIYWTDHGFNLIEVA
RLNGSFRYVIISQGLDQPRSIAVHPEKGFLFWTEWGQVPCIGKARLDGSEKVMIVSVGIT
WPNGISIDYEENKLYWCDARSDKIERIDLDTGANREVLLSGSNVDLFSVAVFGAYIYWSD
RAHANGSVRRGHKNDATETVTMRTGLGVNLKEIKIFNRVREKGTNVCAKENGGCQQLCLY
RGNSRRTCACAHGYLAGDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPVRPYENPNY
FKNIIALAFDYNQRREGTNRIFYSDAHFGNIQLIKDNWEDRQVIVENVGSVEGLAYHRAW
DTLYWTSSSTSSITRHTVDQTRPGAIDREAVITMSEDDHPHVLALDECQNLMFWTNWNEQ
HPSIMRATLTGKNAHVVVSTDILTPNGLTIDHRAEKLYFSDGSLGKIERCEYDGSQRHVI
VKSGPGTFLSLAVYDSYIFWSDWGRRAILRSNKYTGGETKILRSDIPHQPMGIIAVANDT
NSCELSPCALLNGGCHDLCLLTPDGRVNCSCRGDRVLLANNRCVTKNSSCNIYSEFECGN
GDCVDYVLTCDGIPHCKDKSDEKLLYCENRSCRSGFKPCYNRRCVPHGKLCDGTNDCGDS
SDELDCKVSTCSTVEFRCADGTCIPRSARCNQNMDCSDASDEKGCNNTDCTHFYKLGVKS
TGFIRCNSTSLCVLPSWICDGSNDCGDYSDELKCPVQNKHKCEENYFGCPSGRCILNTWV
CDGQKDCEDGLDELHCDSSCSWNQFACSVKKCISKHWICDGEDDCGDSLDESDSICGAVT
CAADMFSCQGSHACVPQHWLCDGERDCPDGSDELSSAGCAPNNTCDENAFMCHNKVCIPK
QFVCDHDDDCGDGSDEFLQCGYRQCGPEEFRCADGRCLVNTLWQCDGDFDCPDSSDEAPI
NPRCRSAEHSCNSSFFMCKNGRCIPSDGLCDIRDDCGDGSDETNCHINECLSKKISGCSQ
DCQDLPVSYKCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCINTYGTYKCHCAEGYETQ
PDNPNGCRSLSDEEPFLILADQHEIRKISTDGSNYTLLKQGLNNVIALDFDYREEFIYWI
DSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLY
PTVLVSKRLKFPRDLSLDPRAGNLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMALT
IDYVNHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRV
HKTSGADRLSLINSWHAITDIQVYHSYRQPDVSKHLCTVNNGGCSHLCLLGPGKTHTCAC
PTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQPG
RFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLAGQFKCTKNKKCIPVNLRCNGQD
DCGDEEDEKDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHE
FQCKNNNCIPDHWRCDNQNDCSDNSDEDNCKPQTCTLKDFLCSNGDCVSSRFWCDGEFDC
ADGSDEKNCETSCSKDQFQCSNGQCLSAKWKCDGHEDCKYGEDEKNCEPAFPVCSSSEYM
CASGGCLSASLKCNGEPDCVDGSDEMDCVIECKEDQFQCKNKAYCIPIRWLCDGIYDCVD
GSDEETCGRGGSICRDDEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCVKFLCPPTRP
YRCRNDRICLQLEKICNGINDCGDNSDEEHCSGKLSLKSKPCKKDEFTCSNRNCIPMELQ
CDSLDDCGDGSDEQGCLKTPIEHTCENNGNPCGDDAYCNQIKTSVFCRCKPGFQRNMKGR
ECADLNECLLFGICSHHCLNTRGSYKCVCDQNFQEKNNSCIAKGSEDQALYIANDTDILG
FVYPFNYSGGHQQISHVEHNSRITGMDVHYQRNVIVWSTQFNPGGIFYKMIDAREKRQAN
SGLICPEFKRPRDIAVDWVAGNVYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNGPNCTR
LLTNMAGEPYAIAVNPKRGMMYWTVIGDHSHIEEAAMDGTLRRVLVQKNLQRPTGLTVDH
FGERIYWADFELSIIGSVLYDGSSPVVSVSSKQGLLHPHRIDVFEDYIYGAGPKNGIFRV
QKFGHGSVEVLALGVDKTKSILVSHRYKQLNLPNPCLDLSCDFLCLLNPSGATCICPEGK
YMMNGTCHDDSLLDDSCKLTCENGGRCILNEKGDLRCHCWPSYSGGRCEVNHCSNYCQNG
GTCIPSTLGRPTCICALGFTGPNCGKAVCEDSCHNGGSCVVTAGNQPYCHCQADYTGDRC
QYYVCHHYCVNSESCTIGNDGSVECVCPTRYEGPKCEIDKCVRCHGGHCIINKDNEDIFC
NCTNGKIASSCQLCDGYCYNGGTCQLDPETSIPVCVCSTNWSGTQCERPAPKSSKSEHIS
TRSIAIIVPLVLLVTLVTTLVIGLVVCKRKRRTKTIRRQPIINGGINVEIGNPSYNMYEV
DHDHSDGGLLEPSFMIDPVKSRYIGGGSSAFKLPHTAPPIYLNSDLKGPLTSGPTNYSNP
VYAKLYMDGQNCRNSLASVDERKELLPKKIEIGIRETVA
NT seq 13800 nt   +upstreamnt  +downstreamnt
atgtcccagttgctccttgccatccttactctctcgggattattgcctaacgctgaggtg
ctgattgtgggagccaaccaagatcagcatttgtgtgaccctggcgaatttctttgccac
gaccatgtgacttgtgtctcccagagttggctgtgcgatggagaccctgactgccctgac
cagtcagatgagtctttagatacctgtcccgaggaggtggagatcaagtgccccttgaat
cacattgcttgccatggctctagcgcatgtgtccatttgtcaaaactgtgcaacggagtg
gtcgattgcccagatggctttgatgaaggagggcattgccaggaattattacccagttgt
cagcagttgaattgccagtttaaatgtgcaatggtcagaaatgctacaagatgttattgc
gaggatggatttgaagtagcagaagatggaagaagctgtaaagatcaagatgaatgcagc
atttatggtatttgcagccagacctgcaagaacacatatgggtcctatgcttgcagctgc
gtggaaggctatataatgcagtcagacaacagatcttgcaaggtcaaacatgaacccaca
gataaggcaccaatgttattaatttcaagtcttgaaacaattgagctcttctacatcaat
ggaagtaaaatgacaactctaagctcagccaacagaaatgaaatccatacgctagatttt
atttatagtgaagaaatgatttgctggattgaatcaagagagtcttctaatcaactcaaa
tgtggccagataacaaaagcaggaagattgacagatcaaaggataattaacagtcttcaa
tccttccaaaatgtggaacaaatggcatttgactggcttaccagaaatatctacttcgtg
gaccatgtcagtgaccggatctttgtttgtaatttcaatggctctgtgtgtgtcactctg
attgaatcggagcttcacaatcctaaggccatagcagcagatcccatcgcaggaaaactt
ttctttactgactatgggaatgttcccaaaatagagagatgtgacttggatgggatgaac
agaacaaggatagtttattcaaaggcagagcagccatcggccctagctttggacctcgtc
aacagattggtttattgggtagatctctacttggactacgtgggagtagtagactaccaa
ggcaaaaacaggcatacaattgttcaaggcagacaggttaaacatctctatggcataact
gtatttgaagattatttatatgcaaccagttctgataacttcaatatcatacgaataaac
agatttaatggcactgatattcactcaataattaaaatggagagtgctcgaggaatccga
acctatcagaagagaacacagccaacagtgagaagccatgcctgcgaagtggatgcatat
ggaatgccagggggatgttcacacatctgtctgctcagcagcagttataagacacggacc
tgtcgctgcaggactggcttcaatatggggagcgatggcaggtcatgcaaaaggccaaag
aatgaattgttcctcttttatgggaaaggacgcccaggaattgttagaggaatggacttg
aataccaaaatagctgatgaatgcatgattcccatagaaaatctggtaaaccctcgtgct
ttagattttcacgcggaagctaattatatctactttgctgacacgaccagtttcttaatt
ggccggcagaagatagatggcacagagagagaaaccatcctgaaagatgatctggataat
gtagaaggtattgcagtggactggattggaaataacctttattggaccaatgatggtcac
agaaaaaccatcaatgtggccaggctggaaaaggcttctcagagccggaaaactctgctg
gaaggaggaatgtctcatccaagagcaattgtggtagatccagtcaacggttggatgtac
tggacagactggaaggaagataaaatagatgacagcgtgggaaggattgagaaagcttgg
atggatggtgtcaatcgacaggtttttgtgacttcaaagatgctgtggccaaatggctta
acactggactttcacaccagcacattatattggtgtgatgcttactatgatcatattgag
aaagtatttttgaatggaacccacagaaaggttgtatacagtggtaaagagctgaaccat
ccttttggactgtcacatcatgggaattatgtgttctggacagattacatgaatggttca
atttttcaactagatttgatgaccaatgaggtgacgttgctgaggcatgaaagagcaccc
ctgtttgggcttcagatttatgatccacgaaaacaacaaggtgacaatatgtgccgcatt
aacaatgggggctgtggcaccctctgcctggccattccagcaggccgagtgtgtgcttgt
gctgataatcaacttttggatgaaaatggaactacttgcacgtttaatcctgaagaaata
aggtttcatatctgtaaacctggagaatttcgctgcaagaacaaacactgtatccaagca
cgatggaaatgtgacggcgacgatgactgcctagacgggagtgatgaggactctgtcaca
tgcttcaatcacagctgtccggatgatcaatttaagtgccagaataatcgttgtatcccc
aagagatggctttgtgatggagcaaatgattgtgggagcaatgaagatgagtctaaccaa
acctgtacagccaggacctgccaggctgaccaattttcttgtggaaatgggcgctgcatt
cccacagcatggctatgtgaccgagaggatgactgtggtgaccagacagatgaagtggca
tcctgtgaatttccaacctgtgagcctctgactcagttcatatgcaagagtgggagatgc
atcagcaacaaatggcactgcgacactgatgatgactgtggagacaggagtgatgaggtg
ggctgtgttcactcctgccttgatgaccagttcagatgttcaagtggccggtgtatccca
gggcactgggcctgtgatggtgacaatgactgcggagacttcagtgatgaaacacatatc
aattgtacaaaagaggaagctcgttctcctgctggttgcatcgggaatgaatttcagtgc
cgtcctgatggaaactgcatccctgatctgtggcgctgtgatggagagaaagactgtgag
gatggcagtgatgagaagggctgcaatggtaccattcgactgtgtgaccacaaaaccaag
ttttcctgcaggagtacagggagatgcatcaacaatgcctgggtatgtgatggagatgtt
gactgtgaagatcagtctgatgaagaagactgtgacagtttcttgtgtggaccacccaag
tacccttgtgctaatgacacctctgtgtgcctgcagccagagaaactctgcaatgggagg
aaggactgtccagatgggtcagatgaaggcgacctttgtgatgagtgttctctgaacaat
ggagggtgtagcaaccactgttctgttgttcctggaagaggaattgtctgttcctgccca
gaaggacatcagctcaagaaagacaatagaacatgtgaaatcgtggactactgtgcctcc
cacctgaggtgcagccaagtgtgtgagcagcaaaaacatatggtcaagtgctcctgctat
gaaggctgggcgttggggactgatggggaaagctgcaccagtgtggattcttttgaggca
ttcatcatcttttctatacgccatgaaattcgaaggattgatctgcataaaggagactac
agcctacttgttcctggactgagaaataccatagcacttgattttcacttcaatcaaagt
ttactttactggacagatgttgtggaagacagaatatacaggggcaagctgtcagagagt
ggaggtgtcagtgccatagaagtggttgtggaacatggcttggcaaccccagaaggcctg
acggttgactggatagctggcaacatttattggatagatagcaatctggaccaaattgaa
gtgtctaaacttgatggttccctgagggctacactaatagcaggagccatggagcatccc
agggccatagcactggatccaagatatggaattcttttctggacagactgggatgccaat
ttccctcgcattgaatctgcttcaatgagtggtgccggaagaaaaaccatctataaagac
atgaaaactggggcatggcctaatggactgaccgtggaccactttgaaagaagaatagtt
tggacggatgccaggtcagatgctatttattcagctttctatgatggaacaaacatgata
gaaattatccgaggacacgagtacctgtcacatccctttgctgtgtctttgtatgggagt
gaggtgtactggactgattggaggaccaacacactggctaaagccaacaagtggacaggg
cagaatgtcagtgtgatccagaagacgagtgcacaaccattcgaccttcagatttaccat
cccagtagacagccacaagctcccaacccttgtgcagccaatgaaggtagaggcccctgc
tctcacctgtgcctcatcaatcataataggagtgcagcttgtgcctgcccccacctaatg
aagctttcctctgacaagaaaacctgctatgaaatgaaaaaatttcttctttatgcaaga
cgttctgagatccgaggggtggacattgacaatccctatgtgaacttcatcacagccttc
actgtcccagatattgacgatgttgctgtaatagacttcgatgcctctgaagagcgtttg
tactggacagacatcaaaacacaaaccattacacgggctttcattaacgggacgggacta
gagacagttatttcaagagatattcagagtatcagagggttagcagtggactgggtttca
cgtaatttatactggattagctcagaattcgatgaaacacaaattaatgtggcaagatta
gatggctctttgaaaacctcaattattcacggaatcgataaaccgcagtgtctggcagcc
cacccagtcagagggaaactgtactggacagatggaaatacaataaacatggcaaatatg
gatggaagtaacagcaagattctctttcagaaccaaaaggaaccagttggtctatcgata
gactatgtggagaataagctttattggatcagttctggaaatggaaccataaaccgatgc
aacctagatggtggtaatttagaagtaatagagtcaatgaaggaagaattaacaaaagct
acagccttaaccatcatggataagaaactctggtgggcagatcaaaacttagctcaactg
ggaacttgtaacaaaagagatggaagaaatcccagcattctgcgaaataagacttccgga
gttgttcacatgaaagtgtatgacaaagaagcacaacaaggcagcaattcttgccaagta
aacaatggtgggtgttctcagctttgcttaccaacatcggaaacaaccaggacttgcatg
tgtacagtgggatattatctccagaagaaccgcatgtcatgccaaggtatagaatctttt
cttatgtactctgttcatgaaggaatccgggggatccctcttgagccacgtgacaaggtg
gatgccctgatgccaatatcaggagctgcttttgctgtggggatagacttccatgcagaa
aatgacaccatctattggacagacatgggccttaataaaatcagcagagctaaaagagac
cagacttggaaagaagacgttgttaccaatggcttgggcagagtggaaggaatagctgtt
gactggattgctggcaacatatattggacagatcatggtttcaatttaattgaggttgca
agactcaatggctcttttcgttatgtaattatttcccaaggactggatcaaccaagatct
atagccgtgcacccagaaaaaggcttcttgttctggactgaatggggacaagtgccttgt
attgggaaagctcgcttagatggttctgagaaggtcatgattgtaagcgtgggaataaca
tggcccaatggcatctccattgactatgaggaaaataaattatactggtgtgatgctcgc
tcagacaagatagagagaattgaccttgacactggtgcgaatcgtgaagtgttgctgtct
gggagcaacgtggatctgttttcagttgcagtctttggggcttacatctactggtctgac
agagcacacgccaatggatcagtcagaagaggccacaagaatgatgccacagagacagta
accatgagaacaggacttggagttaacctaaaggagatcaaaatttttaaccgagtaaga
gagaaagggaccaatgtctgtgccaaagaaaatggtggctgtcagcaactatgtctttat
cgaggaaattcccgaagaacctgtgcctgtgcccatggatatttggctggggatggagtt
acttgtctaaggcatgaaggttatttgctatattcaggaagaacaatattaaaaagcata
catctttctgatgaaaccaatttaaattccccagtacggccctacgagaacccaaattat
ttcaagaatattatagccctggcttttgactataatcaaagaagagaaggtaccaatcgg
atcttttacagtgatgcacactttggaaatatacagcttattaaagataactgggaagac
agacaagtaattgtggaaaatgtgggctctgttgagggcctcgcctatcacagagcctgg
gatactctgtactggaccagctccagcacgtcgtccatcaccaggcacacagtagaccag
actcggcccggagcgattgacagggaagcagtcatcaccatgtcagaggatgatcaccct
catgtgctagctttagatgaatgccaaaatttaatgttttggacaaattggaatgaacag
catcccagcatcatgagagccaccttgactgggaaaaacgcacatgtggtggtcagcaca
gacattcttactccaaatggactcaccattgaccaccgtgctgaaaagctgtatttctca
gatggcagcttaggaaaaattgaaagatgtgaatacgatggatcacaacgacatgtgatt
gtcaagtctggaccaggaacttttcttagtctggcagtttatgacagttatatcttctgg
tcagactggggacgaagagctattttgcgttccaacaagtacacaggaggagaaaccaaa
attcttcgttctgatattccacatcaaccaatgggaatcatagctgttgctaatgacacc
aatagctgcgaactctctccgtgtgcattattaaatggaggttgtcatgacctctgcctt
ttaacaccagatggaagagtgaattgttcctgtagaggggatcgagtattgctagctaac
aacagatgtgtgactaaaaactcttcttgtaatatctattctgagtttgagtgtggaaat
ggggattgtgtagactatgtcctcacctgtgatggtatccctcactgtaaggacaaatcc
gatgaaaagttactctactgtgaaaaccgaagttgccgaagtgggtttaaaccgtgctac
aatcgtcgctgtgttcctcatggcaaactgtgcgatggtacaaatgattgtggggacagc
tctgatgagttggattgtaaagtgtctacctgctccacagttgagttccgctgtgcagat
gggacttgcattccaagatcagcacggtgcaaccaaaacatggactgttcagatgcttca
gatgaaaagggttgcaataatacagattgcacacatttctacaaacttggagtgaaatcc
acaggattcattaggtgtaactctacctcactgtgtgttctaccaagctggatatgtgat
ggatctaatgactgtggagactattctgatgaattaaagtgcccagttcaaaacaaacac
aaatgtgaagagaattattttggttgtcctagtggaagatgcattttgaatacctgggta
tgtgatggtcagaaggactgcgaggacgggctggatgagctacactgtgattcttcttgc
tcttggaatcaatttgcttgttctgtaaaaaaatgtatttctaaacactggatctgtgat
ggagaggatgactgtggagacagcttagatgaaagtgacagcatttgtggtgcagtcact
tgtgctgctgacatgttcagctgccagggctcccatgcctgtgtgccccaacactggctg
tgtgatggtgagagagactgtcccgacgggagtgatgagctatccagtgcaggctgtgca
cccaacaatacatgtgacgaaaatgctttcatgtgccataataaggtgtgcattcccaag
cagtttgtctgtgaccatgacgatgactgtggagatgggtcagatgaattcctacagtgt
ggataccggcagtgtggtccagaagagttccgctgtgctgatgggcgctgcctcgtgaat
actctgtggcagtgtgatggtgactttgactgtcctgacagttccgatgaggctccaatc
aacccaaggtgcaggagtgcagaacattcatgcaacagttcattttttatgtgcaaaaat
ggcaggtgcattcccagtgatggtctttgtgacattagggatgactgcggtgatggctca
gatgagacaaactgccacataaatgaatgtctgagtaagaaaatcagcggatgttctcaa
gactgtcaggatttgccagtcagttacaagtgtaaatgctggcctggattccaactgaag
gatgatggtaaaacatgtgtagacattgatgaatgttcctcaggtttcccctgtagtcag
caatgcatcaatacatatggaacctacaagtgccactgtgcagaaggctatgaaacacaa
cctgataacccaaatggatgcaggtcactctcagatgaagaacccttcttaattctcgcc
gaccaacacgaaattagaaaaattagcacagatggctccaactacacacttctaaagcag
ggattaaacaatgttattgctctagacttcgattatagagaagaattcatatattggatt
gattctagcagacccaatggaagtcgcataaacagaatgtgtctaaatggaagtgacatc
aaggtagtgcataacactgctgtccccaatgcacttgctgttgattggattggcaaaaac
ctttattggtctgacacagagaaaaggataattgaagtatccaaactcaatggcttatac
cctactgtacttgttagcaaaaggctgaagtttcccagggacctgtctttagatccacga
gccgggaatttgtactggattgattgctgtgagtatcctcacattggccgtgtcggaatg
gatggaacaaatcagagtgttgtcatagaaaccaagatttctagacctatggcactaaca
atagattatgtcaaccatagactctattgggctgatgaaaatcacattgaatttagcaac
atggatggatctcatagacacaaagtccctaatcaagatattccaggggtgattgcactc
actttgtttgaagactacatctactggactgatgggaaaaccaagtcactcagccgtgtc
cataaaacctcgggagcagacagactttcactgattaactcatggcatgccatcacagat
atccaggtgtatcattcttatagacaacccgatgtctccaaacatctttgcacagtaaat
aatggaggatgcagccatttgtgccttttaggccctgggaagacccacacctgtgcatgt
cctaccaacttctaccttgcagctgataatagaacttgcttatccaactgcacagccagt
cagtttcgatgcaaaactgataaatgcatccctttctggtggaaatgtgacactgtggat
gactgtggtgatggatctgatgagcctgacgactgtcctgaatttaagtgtcagccaggc
cgatttcagtgtggaacagggctctgtgcactccctgccttcatctgtgacggggagaat
gactgcggtgacaactcggatgaacttaactgtgacacacatgtctgcctggcaggtcag
ttcaagtgtaccaagaacaagaaatgtatcccagtaaacctcagatgtaatggacaagat
gattgtggcgatgaggaagatgagaaggactgtcctgaaaacagctgctctcctgactat
ttccagtgtaagactacaaagcattgcatctccaagctgtgggtttgtgatgaggacccg
gactgtgctgatgcctctgatgaggccaactgtgataaaaagacttgtggacctcatgag
ttccagtgtaagaacaacaactgtattccagatcactggcgatgtgataaccagaatgac
tgcagtgataattctgacgaagacaactgtaagccacagacctgtacactgaaagacttt
ctctgcagcaacggagactgtgtatcatcaaggttctggtgtgatggagagtttgactgt
gctgatggctctgatgagaaaaattgtgaaacaagttgttccaaagatcagtttcagtgt
tctaatggccaatgcctgtcagcgaagtggaagtgcgatggacatgaggactgtaaatac
ggagaagatgagaaaaactgtgagccagcctttcctgtctgctcatcaagtgaatatatg
tgtgccagtggaggatgtctgtcagcatctttgaaatgtaatggagaacctgactgtgtt
gatggttcagatgagatggactgtgtgatagaatgtaaggaagatcagtttcaatgcaaa
aataaagcatactgtataccaatccgatggctgtgcgatggaatttatgattgtgtggat
ggcagtgatgaagagacatgtggcagaggaggaagtatatgcagagatgatgagttcctg
tgcaataactccctttgcaagctccatttctgggtctgtgatggagaagatgactgtggc
gacaactctgatgaagcccctgacatgtgtgtcaaatttctgtgcccacccacgaggcct
tacagatgcagaaatgatagaatctgcctgcaacttgagaagatatgcaacgggattaat
gactgtggggacaactctgatgaagaacactgcagtggtaaactgtcattgaaatccaag
ccttgtaagaaggatgagtttacttgtagcaacagaaactgcatccccatggagctgcaa
tgtgatagccttgatgactgtggtgatggctctgatgaacaaggctgcctgaagactccc
attgaacacacctgtgagaacaatgggaatccatgtggagatgatgcatattgtaatcaa
atcaaaacatctgttttctgtcgctgtaagccaggatttcagagaaacatgaaaggcaga
gagtgtgcagatctcaatgaatgcctgctgtttggaatatgctctcaccactgtctaaac
acacgaggatcatataaatgtgtctgtgaccagaactttcaagaaaaaaacaacagctgt
atagcaaaaggctctgaagatcaagctctctacatagctaatgacactgacatcctgggt
tttgtatatccattcaactacagtggcggtcatcagcagatttctcatgttgaacataat
tcaagaataacagggatggatgtacattatcaaagaaatgtgattgtctggagtactcag
tttaatccaggcgggattttctacaaaatgatcgatgccagagaaaagagacaagcgaat
agtggcttgatttgtcctgaatttaaaagacctcgagacattgccgttgactgggttgca
ggaaatgtttactggacagatcattccagaatgcactggttcagctactatactactcac
tggaccagcctgaggtactccatcaatgtaggacagctcaatggtcccaactgcaccaga
ctcttaacaaatatggctggggagccctatgctattgctgtaaatcctaaaagagggatg
atgtactggaccgtaattggggatcactcccatatagaggaggcagcaatggatggcact
ctgaggagggttttagtacaaaaaaacttacagagacccacaggtctgactgttgatcat
tttggtgaacgcatctactgggcagactttgagctctccatcattggcagtgtcctgtat
gatggttccagtccagtggtctctgtcagcagcaaacaaggtttgttgcatcctcacaga
attgatgtctttgaagattatatatatggagcaggacctaaaaatggtatattcagagtt
caaaaatttggtcatggctcagtagaggtcctagctttaggcgttgacaaaacaaagagc
attttggtatcacatcgctataaacaactaaatttacccaatccttgcttggatttgtca
tgtgactttctctgcttactgaatccttctggagccacatgtatctgcccagagggaaaa
tatatgatgaatgggacctgccatgatgacagtctgttagatgattcttgcaaactgact
tgtgaaaatggaggaagatgcattttaaatgagaagggtgatctgagatgtcactgctgg
cccagttattcaggaggaaggtgtgaagtcaatcattgtagcaattactgtcagaatgga
gggacctgcataccatccactctaggaagacccacctgtatctgtgccctgggctttact
gggcccaactgcggcaaggcagtctgcgaagactcttgtcacaatggtggaagctgtgtt
gtcactgctgggaaccagccttactgccattgccaggcagactacactggagacagatgc
cagtactatgtgtgccaccactattgtgtgaattcagaatcatgtaccattgggaatgat
ggaagtgttgaatgtgtctgcccaacacgctatgaaggaccaaaatgtgagattgacaaa
tgtgtacggtgccatgggggtcactgtattataaataaagacaatgaagatatattttgc
aactgtactaatgggaagattgcctctagctgtcagttatgtgatggctactgttacaat
ggtggcacatgccagctggaccctgagactagtatacctgtgtgtgtgtgctccactaat
tggtcagggacacagtgtgagaggccagccccaaagagcagcaaatctgagcatatcagc
acaaggagcattgctatcatcgtgccacttgtccttttggtgaccttggtaaccactcta
gtgattggtttagtggtttgtaagagaaaaagaagaacaaagacaattagaaggcagcct
atcatcaatggaggaataaatgtagaaatcggcaatccatcatacaatatgtatgaagtg
gaccacgaccacagtgatgggggtcttttagaaccaagtttcatgatagatccagtaaag
tccaggtacatagggggagggtccagtgctttcaagctcccacatacagcaccgcccatc
tacctaaactctgatttgaaaggaccactaacttctgggccaacaaattactccaaccca
gtatatgcaaaattatatatggatggacagaactgtcgaaactccttagcaagtgtggat
gaacggaaagaacttcttccaaagaaaattgaaattggcatcagagaaacagtagcataa

DBGET integrated database retrieval system