KEGG   Mus musculus (mouse): 94221Help
Entry
94221             CDS       T01002                                 

Gene name
Gopc, 2210402P09Rik, AI844555, CAL, FIG, GOPC1, PIST
Definition
(RefSeq) golgi associated PDZ and coiled-coil motif containing
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 DUF903 MAGSP bZIP_1 NPV_P10
Motif
Other DBs
NCBI-GeneID: 94221
NCBI-ProteinID: NP_001186201
MGI: 2149946
Ensembl: ENSMUSG00000019861
UniProt: Q8BH60
Position
10; 10 B3
AA seq 463 aa AA seqDB search
MSAGGPCPAGAGGGPGGSSCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQ
ADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLRSELTETQAEKVVLEKEV
HEQLLQLHSTQLQLHAKTGQSVDSGAIKAKLSVHSVEDLERELEANKTEKVKEARLEAEV
KLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQ
LEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGL
GISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ
RGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGSGNSGASCKDSSGEMKMLQ
GYNKKAVRDAHENGDVGAAGESPLDDTAARAAHLHSLHQKKAY
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgggtggcccatgcccggcgggagccggcggcggcccagggggctcctcctgc
cctgtgggggtctcccctggcggggtgtccatgttccgatggcttgaggtgctggagaag
gagttcgacaaggccttcgtggatgtggatctgcttttgggcgagatcgatccggaccag
gcggacatcacttatgaggggcgtcagaagatgaccagccttagctcctgctttgcgcag
ctatgccacaaagcccagactgtgtcccagatcaaccacaagcttgaggcacagttggtg
gatctgcgatcggaattgacagagactcaagcagagaaagttgttctggagaaagaagtc
cacgagcagcttttacagctgcactccactcagcttcagcttcatgccaagactggtcaa
agtgttgactctggggccatcaaggcaaaattgtctgtccactctgtggaggatctggaa
agagaacttgaagcaaataaaacagaaaaggtaaaagaagctcgacttgaagctgaagtg
aagctactaaggaaggagaacgaggctcttcgaaggcacatagctgttctccaggctgaa
gtttatggggcgaggttggctgccaagtacttggataaggagctggccggcagggtgcaa
cagatacaattactgggacgggatatgaagggacctgctcacgataagctctggaaccag
ttagaagctgaaatacatttgcatcgccacaaaactgtcatcagagcctgcagagggcgc
aacgacttgaagcggcccatgcaagcacccccaggccacgatcaagactctttgaagaaa
agccagggagtcggtccaattagaaaagttctcctccttaaggaagaccatgaaggcctg
ggcatttctatcacaggtgggaaagagcacggtgttcccatcctcatctctgagatccac
ccgggacagcctgcggatagatgtggagggctgcatgttggagatgctattctggcagtc
aatggagtcaacctaagagacacaaagcataaagaagctgtaactatactctcccagcag
agaggagagattgagtttgaagtagtctacgtggcacctgaagtggattctgacgatgaa
aatgtagagtatgaagacgagagtggacaccgctatcgtctgtatcttgacgagttagaa
ggcagtgggaattctggtgctagttgcaaagacagcagtggcgagatgaaaatgttacaa
gggtataacaagaaggcagtgagggatgcgcatgagaatggggacgtgggggctgcaggt
gagagccctctggatgacactgctgcgagagcggctcatctgcacagcctgcatcagaag
aaggcctactaa

DBGET integrated database retrieval system