KEGG   Mus musculus (mouse): 94222Help
Entry
94222             CDS       T01002                                 

Gene name
Olig3, Bhlhb7, bHLHe20, oligo3
Definition
(RefSeq) oligodendrocyte transcription factor 3
  KO
K09085  class B basic helix-loop-helix protein 1/6/7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    94222 (Olig3)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    94222 (Olig3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 94222
NCBI-ProteinID: NP_443734
MGI: 2149955
Ensembl: ENSMUSG00000045591
Vega: OTTMUSG00000063742
UniProt: Q6PFG8
Position
10; 10 A3
AA seq 273 aa AA seqDB search
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHHQESRLNSVSSTQGDMVQKMPGESLSRA
GAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVR
KLSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVH
PVHPILGGALSSGNASSPLSATSLPTIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPC
PCTICQMPPPPHLSALSTANMARLSAESKDLLK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgattcgagctctgtctccagcagagcgtcatctccggacatggatgagatg
tacctaagagaccaccaccaccgccaccaccaccaccatcaggagagtcgtctgaactcg
gtctcctccacacagggcgatatggtccagaagatgccaggggaaagcctctcgagggca
ggcgccaaggctgcaggagaaagcagcaagtacaaaatcaagaagcagctgtcggagcag
gatcttcagcagttgcggctgaagatcaacggacgcgaacgcaagaggatgcacgacctg
aacctcgccatggatggtctgcgcgaggtcatgccctacgctcacgggccctcggtgcgc
aagctctccaagatcgccactctgcttctggccagaaactacatcctcatgctcaccagc
tccctggaggagatgaagaggttggttggagagatctacgggggacaccactcggccttc
cactgtgggactgtggggcattcggccggccacccggcacacgcagccaacgctgtgcac
ccggtgcaccctatcctgggcggcgcgctctcctctggcaatgcctcgtcccctctgtcc
gcgacctccctgccgaccattggcaccatccgtcctccccactcactgctcaaggcgccc
tccacgccgcccgcgctacaattgggcagcggcttccagcactgggcggggctgccctgt
ccctgcaccatctgccagatgccaccaccgccgcacctgtccgctctctccaccgccaac
atggcccggctttcggctgaatccaaggacttgctcaagtga

DBGET integrated database retrieval system