KEGG   Mus musculus (mouse): 94224
Entry
94224             CDS       T01002                                 

Gene name
Srd5a2, 5AR, 5ART2, S5AR_2
Definition
(RefSeq) steroid 5 alpha-reductase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    94224 (Srd5a2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    94224 (Srd5a2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     94224 (Srd5a2)
SSDB
Motif
Pfam: Steroid_dh DUF1295
Other DBs
NCBI-GeneID: 94224
NCBI-ProteinID: NP_444418
MGI: 2150380
Ensembl: ENSMUSG00000038541
UniProt: Q99N99
Position
17; 17 E2
AA seq 254 aa
MPIVCHQVPVLAGSATLATMGTLILCFGKPASYGKHSESVSSGVPLLPARIAWFLQELPS
FVVSVGMLAWQPRSLFGPPGNVLLGLFSAHYFHRTFIYSLLTRGRPLSAVIFLKATAFCI
GNGLLQAYYLVYCAEYPEEWYTDMRFSVGVFFFILGMGINIHSDCMLRQLRKPGEVIYRI
PQGGLFTYVSGANFLGEIIEWMGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFK
DYPKSRKALIPFIF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccgattgtgtgccatcaggtcccggtgctggcaggtagcgccacattggccaccatg
gggaccctgatcctgtgctttgggaaacccgccagttacgggaaacacagcgagagtgtg
tcgtcgggagttcccctcctgcccgcacgcatagcctggttcctgcaggagctgccttcc
tttgtggtgtcggtagggatgctcgcttggcagccgcgctccctctttggacctccgggg
aatgtgctgctgggtctcttctccgcacattacttccacaggacatttatttactcattg
ctcaccagaggcaggcctttatcagcggtgatctttctgaaagccactgccttctgcata
gggaacggactcctgcaagcctattacctggtttattgcgcggaataccctgaggagtgg
tacacagacatgcggtttagcgtcggtgtcttcttctttattctggggatggggatcaac
atccacagtgactgcatgctgcgccagctcaggaagcccggagaggtcatctacaggatc
ccacaaggtggcttgtttacgtatgtgtctggagccaatttcctgggcgagattattgaa
tggatgggctacgctttggccacttggtctgttccagcctttgcttttgcatttttcaca
ctttgtttcctggggatgcaagctttttaccaccacaggttctacctcaagatgtttaag
gattaccccaaatctaggaaagccctcattccattcatcttttaa

DBGET integrated database retrieval system