KEGG   Mus musculus (mouse): 94229
Entry
94229             CDS       T01002                                 

Symbol
Slc4a10, NCB, NCBE, mKIAA4136
Name
(RefSeq) solute carrier family 4, sodium bicarbonate cotransporter-like, member 10
  KO
K13861  solute carrier family 4 (sodium bicarbonate transporter), member 10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    94229 (Slc4a10)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   94229 (Slc4a10)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto CPT
Other DBs
NCBI-GeneID: 94229
NCBI-ProteinID: NP_001229309
MGI: 2150150
Ensembl: ENSMUSG00000026904
Vega: OTTMUSG00000012738
UniProt: Q5DTL9 Q8C943
Position
2; 2 C1.3
AA seq 1118 aa
MEIKDQGAQMEPLLPTRNDEEAVVDRGGTRSILKTHFEKEDLEGHRTLFIGVHVPLGGRK
SHRRHRHRGHKHRKRDRERDSGLEDGRESPSFDTPSQRVQFILGTEDDDEEHLPHDLFTE
LDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCILNGTVL
LDMHANTIEEIADMVLDQQVSSGQLNEDVRHRVHEALMKQHHHQNQKKLANRIPIVRSFA
DIGKKQSEPNSMDKNAGQVVSPQSAPACAENKNDVSRENSTVDFSKGLGGQQKGHTSPCG
MKQRLDKGPPHQQEREVDLHFMKKIPPGAEASNILVGELEFLDRTVVAFVRLSPAVLLQG
LAEVPIPSRFLFILLGPLGKGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEF
LDQVTVLPPGEWDPSIRIEPPKNVPSQEKRKIPAVPNGTAAHGEAEPHGGHSGPELQRTG
RIFGGLILDIKRKAPFFWSDFRDAFSLQCLASFLFLYCACMSPVITFGGLLGEATEGRIS
AIESLFGASMTGIAYSLFGGQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLW
TATLCIILVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLFELSETYPINMHNDLE
LLTQYSCNCMEPHSPSNDTLKEWRESNLSASDIIWGNLTVSECRSLHGEYVGRACGHGHP
YVPDVLFWSVILFFSTVTMSATLKQFKTSRYFPTKVRSIVSDFAVFLTILCMVLIDYAIG
IPSPKLQVPSVFKPTRDDRGWFVTPLGPNPWWTIIAAIIPALLCTILIFMDQQITAVIIN
RKEHKLKKGCGYHLDLLMVAVMLGVCSIMGLPWFVAATVLSITHVNSLKLESECSAPGEQ
PKFLGIREQRVTGLMIFILMGSSVFMTSILKFIPMPVLYGVFLYMGASSLKGIQLFDRIK
LFWMPAKHQPDFIYLRHVPLRKVHLFTVIQMSCLGLLWIIKVSRAAIVFPMMVLALVFVR
KLMDFLFTKRELSWLDDLMPESKKKKLEDAEKEEEQSMLAMEDEGTVQLPLEGHYRDDPS
VINISDEMSKTAMWGNLLVTADNSKEKESRFPSKSSPS
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggagattaaagaccagggagcccaaatggagccgctgctgcctacgagaaatgatgaa
gaagccgttgtggatagaggtggaacacgctctattctcaaaacacattttgagaaagaa
gatttagaaggtcatcggacattatttattggagttcatgtgcccctgggtggaagaaaa
agccatcgtcgtcacaggcatcgtggtcataagcacagaaagagggacagagagagagat
tcgggactggaggatggaagagagtccccttcttttgacaccccatcgcagagggtgcag
tttattcttggaactgaggacgatgatgaggagcacctccctcatgaccttttcacagag
ctggatgagatttgctggcgtgaaggggaagatgctgagtggcgagagacagccaggtgg
ttgaaatttgaagaggatgtggaagatggaggagaaagatggagtaagccctatgtggcc
acgctttcattacacagcttgtttgagttgagaagctgcatcctgaatggaactgtgcta
ctggacatgcatgccaacacgatagaagaaattgcagatatggtccttgaccagcaggtc
agctcaggccagctgaatgaagatgttcgccacagggtccacgaagcattgatgaagcag
catcatcaccagaatcagaaaaaactggctaacaggattcctattgtccgatcttttgct
gatattggcaagaaacaatcagaaccaaattccatggataaaaatgcaggtcaggttgtt
tctcctcagtctgctccagcctgtgctgagaataaaaatgatgtcagcagggaaaacagc
actgtagacttcagcaagggactgggaggccaacaaaaggggcatactagtccatgtggg
atgaaacaaaggcttgacaaaggacctccacaccagcaggagagagaggttgatctgcat
tttatgaaaaagattcctccgggtgctgaagcttcaaacatcttggtaggagaactggag
ttcctagacagaactgtggttgcctttgtcaggttgtctccagctgtcttgctccaagga
cttgctgaagttccaatcccaagcagatttctgttcatccttctgggacccctgggaaag
ggtcaacagtaccacgagattggcagatcgattgcgaccttaatgactgatgaggtgttt
catgatgttgcttacaaagctaaagaccgcaatgacttggtatcaggaattgatgagttt
ctggatcaggttaccgttcttcctcctggagaatgggatccaagcatacgaatagaacct
cccaaaaatgtcccttcccaggagaagaggaagattcctgctgtaccaaatggaacagca
gctcatggcgaagctgagccacatggaggacacagcggacctgaactccagcgaactggg
aggatttttgggggacttatattagatatcaaaagaaaggctccattcttctggagtgac
ttcagggatgctttcagcctgcagtgcttagcatcgttcctgtttctctactgtgcatgc
atgtctcctgtcatcacatttggaggactgttgggagaagcaactgaaggtcgtataagt
gcaatcgaatcactctttggagcatctatgaccgggatagcctattctctttttggtgga
cagcccctgaccatattaggcagcacaggacctgttttggtgtttgaaaagatcttgttt
aagttttgcaaggaatacggcctgtcgtacttgtccttacgggccagcattgggctctgg
actgcaacactgtgcatcatccttgtggccacggacgcgagctcactcgtctgctacatc
acccggtttaccgaagaggcttttgcttctctcatttgcatcatttttatctatgaagcc
ctggagaagttgtttgagctcagtgaaacctatccaatcaatatgcacaatgatttggaa
ctgctgacacaatactcatgtaactgtatggagccacatagtcccagcaatgacacactg
aaggaatggcgggagtccaacctttctgcctctgacataatctgggggaacctaactgtg
tcagagtgcagatcactgcacggggagtatgtcgggcgagcctgtggccatggccacccc
tacgtgccagatgttctcttctggtcggtgatcctgttcttctccacagttaccatgtca
gccaccctgaagcagttcaagaccagccgctatttcccaaccaaggttcgatccatagtg
agtgattttgcggtttttcttacaattctgtgtatggttttaattgactatgccattggg
atcccatcaccaaaactacaagtaccaagcgttttcaagccgaccagagacgaccgtggc
tggtttgttacacctttgggtccaaacccatggtggacaatcatagctgccatcatccca
gctttactctgtactattctgattttcatggaccagcagattacagctgtcatcatcaac
agaaaagagcacaagctaaagaaaggttgtggctatcacctggatctgttaatggtggca
gtcatgctcggggtctgctccattatgggcctgccatggtttgtggctgccacagttctc
tccatcactcatgtcaacagcctcaagctcgaatcagagtgctctgctccaggagaacaa
cccaagtttctcggcattcgggagcagagggtgaccgggctcatgatttttattcttatg
ggttcatccgttttcatgaccagcattctgaagtttatccccatgccagtgttatacgga
gtgtttctttatatgggtgcttcgtctctcaaaggaattcagttatttgatagaataaag
ctcttctggatgccagccaaacatcaaccagatttcatctatctaaggcacgtgcccctc
cggaaagtccatctcttcacagtcattcagatgagttgtctcggccttctgtggataatc
aaagtttcgagagctgctattgtctttcctatgatggtgttggcactagtgtttgtgaga
aagttgatggacttcttgtttaccaaacgggaactcagctggcttgatgatttaatgcct
gagagtaaaaagaagaaacttgaagatgctgagaaagaagaagaacaaagtatgctagcc
atggaggacgagggcacagtacaactcccactggagggacactacagagacgacccgtct
gtgatcaatatttctgatgaaatgtcaaagactgccatgtgggggaaccttctagttact
gctgacaactcaaaagaaaaggagtcacgctttccttctaaaagctccccttcctaa

DBGET integrated database retrieval system