KEGG   Mus musculus (mouse): 94246
Entry
94246             CDS       T01002                                 

Gene name
Arid4b, BCAA, BRC, BRCAA1, RBBP, RBBP1L1, Rbp, Rbp1l1, SAP, SAP180
Definition
(RefSeq) AT rich interactive domain 4B (RBP1-like)
  KO
K19195  AT-rich interactive domain-containing protein 4B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    94246 (Arid4b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     94246 (Arid4b)
SSDB
Motif
Pfam: RBB1NT ARID Tudor-knot Tudor_2
Other DBs
NCBI-GeneID: 94246
NCBI-ProteinID: NP_919238
MGI: 2137512
Ensembl: ENSMUSG00000039219
Vega: OTTMUSG00000018144
UniProt: A2CG63
Position
13 A1; 13 5.29 cM
AA seq 1314 aa
MKALDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGPL
KVGAIVEVKNLDGAYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDDDEEERKQTDELLGKVVCVD
YVSLEKKKAMWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTVPK
PDAVLKQAFDQALEFHKSRAIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEE
EIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGA
VWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIDFQMALPEKVLNKPCKDC
ENKEVKVKEESETEIKEVNVEDSKNVMPKEETPAEDESERKENIKPSLGSKKSLLECIPA
QSDEEKEAHITKLEENENLEDKDGGRARTEEAFSTEVDGEEEQARSGDETNKEEDEDDEE
IEEEEEEDEEEDEDEDDDDNNEEEEFECYPPGMKVQVRYGRGKNQKMYEASIKDSDVEGG
EALYLVHYCGWNVRYDEWIKADKIVRPADKNVPKIKHRKKIKNKLDKEKDRDEKYSPKNC
KLRRLSKSPFQSNPSPEMVSKLDLADAKNSDTAHIKSIEITSILNGLQASESSAEDSEQE
DERCTQDVDNIGKDESKVEHSTHSRNELISKEEQSSPSLLEENKVHTDLVIAKTVSKSPE
RLRKDMEAISEDTDFEEEDEITKKRKDVKKDTTDKALKPQTKRGKRRYCSADECLQTGSP
GKKEDRTKSKEPLCTENSSNSSSDEDEEEKSKAKMTPTKKYNGLEEKRKSLRTTSFYSGF
SEVAEKRIKLLNNSDERLQNNRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHP
APDEGAVEESLQTVAEEESCSPIMELEKPLPASVDNKPIEEKPLEVSDRKTEFPSSGSNS
VLNTPPTTPESPSSVTITEASQQQSSVTVSVPLPPNQEEVRSIKSETDSTIEVDSVVGEL
QDLQSEGNSSPAGFDASVSSSSSNQPEPDNPEKACTGQKRVKDTQGVGSSSKKQKRSHKA
TVVNNKKKGKGTNSSDSEELSAGESVTKTQTIKSVPTGMKTHNSKSPARVQSPGKGGRNG
DKDPDLKEPSNRLPKVYKWSFQTSDLENMTSAERISILQEKLQEIRKHYLSLKSEVASID
RRRKRLKKKERESAATSSSSSSPSSSSITAAVMLTLAEPSMSSASQNGMSVECR
NT seq 3945 nt   +upstreamnt  +downstreamnt
atgaaggcccttgatgaacctccttatttgacagtgggcactgatgtgagtgccaaatac
agaggagccttctgtgaagccaagatcaagactgcaaaaagacttgtcaaagtcaaggtg
acttttagacacgattcttcaacagtggaagttcaggatgaccacataaagggcccactg
aaggtaggagctattgtggaagtgaagaatcttgatggtgcctatcaggaagcggttatc
aataaactgacagatgcaagttggtatactgtggtttttgatgatggagatgagaagaca
ctgagaagatcttcattatgtctgaaaggagagagacattttgctgaaagtgaaacacta
gaccagctcccactcaccaatcctgagcattttggcactccagtcataggaaagaaaaca
aatagaggaagaagatctaaccatataccagaggaggagtcttcctcctcatccagtgat
gacgatgaggaggagaggaaacagactgatgagctactaggcaaagttgtttgtgtagat
tatgttagcttggagaaaaagaaagcgatgtggtttcctgcactggtggtttgtcctgac
tgtagtgatgagattgctgtgaaaaaagacaatattcttgttcggtctttcaaagatggc
aaatttacttcagttccaagaaaagatgtccatgaaattactagtgacactgtaccgaag
cctgatgctgtattaaaacaagcctttgatcaggcacttgagtttcacaaaagtagagct
attcctgctaattggaagactgaattgaaagaagacagctccagtagtgaagctgaggag
gaggaggaggaggaagatgatgaaaaagagaaagaagataacagcagcgaagaagaggaa
gaaatagaaccatttccagaggaaagggagaactttcttcagcagctgtataagttcatg
gaggatagaggtacacctattaacaaacggcctgtgcttgggtatcgaaatttgaatctt
tttaagttattcagacttgtgcacaaacttggagggtttgataatattgaaagtggagct
gtttggaagcaagtctatcaagaccttgggatccctgtcttaaattcagctgcaggatac
aatgttaaatgtgcttataaaaagtacttatatggctttgaggagtactgcaggtcggct
aatattgactttcagatggcattgccagagaaagttcttaacaagccatgtaaagattgt
gaaaataaagaagtaaaagttaaggaagaaagtgaaacagagattaaagaagtaaatgtg
gaagacagtaagaacgtgatgccaaaagaggagacgcctgctgaggatgaaagtgaaaga
aaagaaaatatcaagccctctctgggaagtaaaaaaagcttattagaatgtatacctgca
caatctgatgaagaaaaagaagctcacattacaaaactcgaagaaaatgaaaacttggaa
gataaagacggtggcagagctaggaccgaggaggccttcagcacagaggtagatggtgaa
gaagagcaagcacgatctggagatgaaaccaataaagaagaagatgaagatgatgaagaa
atagaagaggaggaggaagaagacgaggaagaagacgaggatgaagatgatgatgacaac
aatgaagaagaggagtttgagtgctatccaccaggcatgaaagtccaagtgcggtatgga
cgagggaaaaatcaaaaaatgtatgaagctagtataaaagattctgatgtcgaaggtgga
gaggccctttacttggtgcattactgcggatggaatgtgagatatgatgaatggattaaa
gcagataaaatagtaagacctgctgataaaaatgtaccaaagatcaaacatcggaagaaa
ataaagaataaactagacaaagaaaaagacagagatgaaaaatactctcctaagaactgt
aaacttcgacgcttgtcaaaatcaccgtttcagtcaaatccatctcctgagatggtttcc
aaactagatcttgctgatgccaaaaactctgatacagctcatattaaatctatagaaatt
acttccattcttaatggactacaagcttctgaaagttcggctgaagacagtgagcaggaa
gatgagagatgtactcaggacgtagataacattggcaaagacgaatcaaaggtggaacat
tcaacccacagcagaaatgaactgatttcaaaagaggaacagagtagtccatctttgcta
gaagaaaacaaagtccatacagatttggtaatagccaaaacagtgtcaaaatctccagaa
agattaagaaaagatatggaagcaatatcggaagatactgattttgaagaggaagatgaa
atcacaaagaagagaaaggatgttaaaaaggacacaacagacaaggctttaaagccacaa
acaaaacgtgggaaaagacggtattgcagtgcagatgaatgtttgcagactggatcccct
ggcaagaaggaagacagaaccaagagtaaagagccgctctgcacagaaaacagtagtaac
agctcctcagatgaagatgaagaagaaaagtccaaagcaaagatgacaccaaccaagaaa
tataatggcttagaagaaaagagaaaatctctgcggacaactagtttctattcaggattt
tcagaagtagcagaaaaaaggataaagcttttaaataactctgatgaaagacttcagaac
aacagggctaaagatagaaaagatgtctggtcaagtattcagggacagtggcctaagaaa
acgctaaaggagcttttctctgactcggacactgaggctgcagcttctccaccccatcct
gccccagatgagggggcagtagaggagtcactgcagactgtggcagaagaggagagttgt
tcacccattatggagctagaaaagccactacctgccagtgttgacaataagcccattgaa
gaaaaacccctagaagttagtgataggaaaacagaatttccgagcagtggcagtaattca
gtgctcaataccccacctaccacaccagagtcgccttcttcagtcactataacagaagct
agtcagcagcagtcttctgtcacagtgtcagtgcccctgcctccaaaccaggaagaggtt
cgaagcattaagagtgaaactgacagcacaattgaggtggacagtgttgtgggggagctc
caggacctccagtcggaggggaatagctcaccagcaggctttgatgcgagcgtgagttcc
agcagtagcaatcagccagaaccagataacccagaaaaagcctgtacaggtcagaaaaga
gtgaaagatactcagggagtaggaagttcatcaaaaaagcagaagagaagccataaagcc
accgtggtgaacaacaaaaagaagggaaaaggcacaaacagtagtgacagtgaagaactc
tcagctggtgaaagtgtgactaagactcagacaatcaagtcagtccccaccggaatgaag
acccacaacagcaagtctccagcaagggtacagtctccaggaaaaggtggcaggaatggg
gataaagaccctgatctcaaggagcctagtaaccggcttcccaaggtttacaagtggagt
tttcagacgtcggacctggaaaatatgacaagtgctgaacgtatctcaattcttcaagaa
aaattgcaagaaatcagaaagcattatctgtctttaaaatctgaagtagcttccattgat
aggaggagaaaacgtttaaagaagaaagagagagaaagtgctgctacatcttcttcctcc
tcttctccctcgtccagctccatcacagctgctgttatgttgacactagctgaaccatca
atgtccagtgcatcacagaatggaatgtcagttgagtgcaggtga

DBGET integrated database retrieval system