KEGG   Mus musculus (mouse): 94279Help
Entry
94279             CDS       T01002                                 

Gene name
Sfxn2, C79732, F630107H02Rik
Definition
(RefSeq) sideroflexin 2
  KO
K23501  sideroflexin-2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    94279 (Sfxn2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    94279 (Sfxn2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    94279 (Sfxn2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC56: Sideroflexin
   94279 (Sfxn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mtc
Motif
Other DBs
NCBI-GeneID: 94279
NCBI-ProteinID: NP_444426
MGI: 2137678
Ensembl: ENSMUSG00000025036
UniProt: Q925N2 Q3UC14
Position
19; 19 C3
AA seq 322 aa AA seqDB search
MEGDLSGFNIDAPRWDQCTFLGRVKHFFNITDPRTVFASEQELDWAKAVVEKSRMGLVPP
GTQMEQLLYAKKLYDSAFHPDTGEKMNVIGRMSFQVPGGMLITGFMLQFYRTMPAVIFWQ
WVNQSFNALVNYTNRNAASPTSVRQMALSYFTATTTAVATAVGMNMWTKRAPPLVGRWVP
FAAVAAANCVNIPMMRQQELIQGICVKDRNQNELGHSQRAAAVGIAQVVISRITMAAPGM
ILLPVIMERLERLHLMKKVKVMHAPLQVLLCGCFLLFMVPVACGLFPQECELSVSYLEPE
LRDTIKAKYGEQVLFVYFNKGL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggagggggatctgtctggctttaatattgatgctccccgctgggaccagtgcactttc
ctggggcgcgtgaagcacttttttaacatcacagatcctcgcacggtctttgcatcagag
caggagctggactgggccaaggcggtggtggagaagagcaggatgggacttgtgccccct
ggcactcagatggagcagctgctgtatgcgaagaagctctacgactcggccttccaccct
gacactggggagaagatgaatgtcattgggcggatgtccttccaggtccctggtggcatg
ctcatcacgggcttcatgctccagttctacaggacaatgcctgcagtcattttctggcag
tgggtgaaccagtcctttaatgccttggtcaactacaccaacaggaatgcagcttccccc
acgtctgtcaggcagatggccctctcctacttcacagctactactactgcggtggccact
gcagtgggcatgaacatgtggacaaagagagccccacccttggtgggccgatgggtgcct
tttgccgctgtggctgccgctaactgtgtcaatatcccaatgatgcgacagcaggaactc
attcagggcatctgtgtgaaggacaggaaccaaaatgagcttggccattctcagagagct
gcggctgtgggcatcgcacaagtggttatctctcggatcaccatggcagcccctggcatg
atcctgttgcctgtcatcatggagaggctggagagactacacctgatgaagaaggtcaaa
gtgatgcacgcccccctgcaggtcttgctgtgtggctgcttcctcctctttatggtgcca
gtggcgtgcggactcttccctcaggaatgtgaattatcagtttcctatctagagccagag
ctacgggacaccatcaaggccaagtatggagaacaagtcctctttgtctactttaataag
ggtctctaa

DBGET integrated database retrieval system