KEGG   Mus musculus (mouse): 94315
Entry
94315             CDS       T01002                                 

Gene name
Prcc
Definition
(RefSeq) papillary renal cell carcinoma (translocation-associated)
  KO
K13105  proline-rich protein PRCC
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    94315 (Prcc)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    94315 (Prcc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    94315 (Prcc)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19-related factors
    94315 (Prcc)
SSDB
Motif
Pfam: PRCC
Other DBs
NCBI-GeneID: 94315
NCBI-ProteinID: NP_291051
MGI: 2137738
Ensembl: ENSMUSG00000004895
Vega: OTTMUSG00000030643
UniProt: Q9EQC8
Position
3; 3 F1
AA seq 491 aa
MSLVAYASSDDSEPDEPEPEPEPEEEDVAAPMPGPTLGGLFASLPAPKGPALLPPPPQML
APAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPAGVSPAEAAGVGEGLGLPSPQGPGL
SLPPAVGGVGPPLGLPKPKKRTEPVRIAAPELQKGDSDSEEDEPAKKKVVLQGSGEGTGL
SALLPQPKNLTVKETNRLLLPHAFSRKPSDISSDAKPSRLASKTKPASLAPVLGTTTTTP
SPSAIKAAAKSAALQVTKQITQEDDDSDEEVAPENFFSLPDKAEPPGVEPYPYPVPTVPE
ELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYY
QDYYSGGYYPAPDPALVPPQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKL
SRRQTQAKYGF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtctctggttgcttatgccagcagcgacgatagtgagccggatgagccggagccggag
ccggagccggaggaagaggatgtggcggctcctatgccagggcccactttaggaggcctg
ttcgcttctcttcctgcacccaaaggcccggccttgctgcccccgcccccccagatgctg
gccccagccttccccccgccgctcctgctgcccccgcccaccggagaccccagactgcag
ccgcctccgccgctgccctttggcctgggcggcttcccgccacctgcaggagtgagccct
gctgaagctgcgggagttggagaggggctggggctgccatcgcctcaaggccctgggctc
agtctgcccccagctgtgggcggtgtcggaccccccttgggccttcccaagccaaagaag
agaaccgaaccggttaggatagcggcgccggagctgcagaagggcgattcagattctgag
gaagatgaacctgcgaagaagaaagttgtcctgcagggatccggcgaggggactggtttg
tctgccttgctcccccaacctaaaaacctgactgtgaaagagactaacaggttgctcctg
ccccatgccttctcccggaaaccttcagatatctcctcagatgctaagccctctagattg
gcttctaagaccaagcccgcctcacttgctcctgttttgggtaccacaaccaccactcca
tcaccctctgccatcaaggctgctgccaagagtgctgccctgcaggtgaccaagcagata
acacaggaggatgacgacagtgacgaggaagttgctcctgagaactttttctccctccct
gacaaggctgagccacctggagttgagccatacccttaccctgtccccactgtccctgaa
gagctgcctccaggcacagaaccagaaccagctttccaggacgatgcagccaatgccccc
cttgagtttaagatggcggcagggtcaagtggagctccctggatgccgaagcctggggat
gactacagctacaatcagttttccacatatggcgatgccaatgctgctggtgcttattat
caggattactacagtggtggctactatcctgcaccggacccggctctggtccctccccag
gaaattgcccctgatgcctccttcattgatgatgaagcatttaagcggctacagggcaag
aggaaccgagggagagaggaaatcaactttgtggagatcaaaggtgatgaccaactcagt
ggggctcagcagtggatgaccaagtcactgacagaagagaaaaccatgaagtccttcagc
aaaaagaaaggtgaacagccaactggccagcagcggaggaaacaccagatcacatatctg
attcatcaggctaaggagcgggagctggagctgaagaacacctggtcagaaaacaagctc
agtcgccggcagacccaagccaaatatggattctag

DBGET integrated database retrieval system