KEGG   Mus musculus (mouse): 94352
Entry
94352             CDS       T01002                                 

Gene name
Loxl2, 1110004B06Rik, 4930526G11Rik, 9430067E15Rik
Definition
(RefSeq) lysyl oxidase-like 2
  KO
K00280  lysyl oxidase-like protein 2/3/4 [EC:1.4.3.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    94352 (Loxl2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     94352 (Loxl2)
SSDB
Motif
Pfam: Lysyl_oxidase SRCR SRCR_2 Hepsin-SRCR
Other DBs
NCBI-GeneID: 94352
NCBI-ProteinID: NP_201582
MGI: 2137913
Ensembl: ENSMUSG00000034205
Vega: OTTMUSG00000044487
UniProt: P58022
Position
14; 14 D2
AA seq 776 aa
MELHFGSCLSGCLALLVLLPSLSLAQYEGWPYQLQYPEYFQQPAPEHHQRQVPSDVVKIQ
VRLAGQKRKHNEGRVEVYYEGQWGTVCDDDFSIHAAHVVCRQVGYVEAKSWAASSSYGPG
EGPIWLDNIYCTGKESTLASCSSNGWGVTDCKHTEDVGVVCSEKRIPGFKFDNSLINQIE
SLNIQVEDIRIRPILSAFRHRKPVTEGYVEVKEGKAWKQICNKHWTAKNSHVVCGMFGFP
AEKTYNPKAYKTFASRRKLRYWKFSMNCTGTEAHISSCKLGPSVTRDPVKNATCENGQPA
VVSCVPSQIFSPDGPSRFRKAYKPEQPLVRLRGGAQVGEGRVEVLKNGEWGTICDDKWDL
VSASVVCRELGFGTAKEAITGSRLGQGIGPIHLNEVQCTGTEKSIIDCKFNTESQGCNHE
EDAGVRCNIPIMGFQKKVRLNGGRNPYEGRVEVLTERNGSLVWGTVCGQNWGIVEAMVVC
RQLGLGFASNAFQETWYWHGNIFANNVVMSGVKCSGTELSLAHCRHDEEVACPEGGVRFG
AGVACSETAPDLVLNAEIVQQTAYLEDRPMSLLQCAMEENCLSASAVHTDPTRGHRRLLR
FSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKASFCL
EDTECEGDIQKSYECANFGEQGITMGCWDMYRHDIDCQWIDITDVPPGDYLFQVVINPNY
EVPESDFSNNIMKCRSRYDGYRIWMYNCHVGGAFSEETEQKFEHFSGLLNNQLSVQ
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggagctccattttggctcctgcctctccggctgtttggctctgcttgtcttgctgcct
tccctgagcctagcacagtacgagggctggccctaccagctccagtaccctgagtacttc
cagcagcccgctcctgagcaccatcagcggcaggtgccctccgatgtggtcaagatccag
gtccgcctggcgggccagaagaggaagcacaatgagggccgcgtggaggtctactacgaa
ggccagtggggcacggtgtgcgacgatgacttctcgatccatgccgcccatgtggtctgc
cggcaagtgggctatgtagaggccaagtcctgggctgccagctcctcctacggtccaggc
gaaggccccatctggttggacaatatctactgtactggcaaagagtcgaccctggcatct
tgctcctccaatggctggggtgtcactgactgcaagcacactgaagacgttggagtggtg
tgtagtgagaaaagaattcctggcttcaaatttgacaattcgttgatcaaccaaatagag
agcctaaatatacaggtggaagacatccggattcggcccatcctttctgcctttcgccat
cgcaagcctgtgacagagggctacgtggaggtgaaggagggcaaggcttggaagcagatc
tgcaacaaacactggacagccaagaattcccacgtggtctgtggcatgttcggcttccct
gcagagaagacctacaaccccaaagcctataaaacctttgcctcgcggaggaagctgcgt
tactggaagttttctatgaactgcacgggcactgaagcgcatatctccagctgcaagctg
ggcccttccgtgacccgggaccctgtgaagaacgccacctgtgagaacgggcagccagct
gtggtcagttgtgtgcctagccagatcttcagccccgatggaccctcaaggttccggaaa
gcctacaagccagagcaacccttggtgcgcctgagaggtggagcccaggtcggggagggc
cgagtggaggtgctgaagaatggagaatggggaaccatctgcgatgacaagtgggacctg
gtatctgccagtgtggtctgccgagagctgggctttgggaccgctaaagaggccatcaca
ggctccagactagggcaagggattgggcccatccatctcaatgaagtccagtgcacaggg
actgagaagtccatcatagactgcaaattcaacacagagtctcaaggctgcaaccatgaa
gaagatgccggggtgcgatgcaacatccccatcatgggtttccagaaaaaggtgcgcctg
aatggaggccgcaatccttatgagggccgagtggaggtgctaacagagagaaatgggtcc
cttgtttgggggactgtatgcggccagaactggggcattgtggaagccatggtggtctgc
cggcagctaggcctgggctttgccagcaatgcctttcaggagacctggtactggcatgga
aatatcttcgccaacaacgtggtcatgagtggagtgaagtgctcaggaacggagctgtcc
ctagcacactgccgccatgacgaggaggtggcctgccccgagggcggggtgcggtttggt
gctggagtcgcctgctcggaaactgcacctgacctggtgcttaatgctgagattgtccag
cagactgcctacctggaggacaggcccatgtccttgctgcagtgtgccatggaggagaac
tgcctctccgcctccgctgtgcacaccgaccccaccagaggccaccggcgccttttacgc
ttctcctcccagatccacaacaatggccagtctgacttccgccccaagaatggccgccat
gcgtggatttggcacgactgccacaggcactaccacagcatggaagtcttcacttactat
gacctgctgagcctcaacggcaccaaggtggctgagggccacaaggccagcttctgcctg
gaggacactgagtgtgagggagacattcagaagagttacgagtgtgccaactttggagaa
caaggcatcaccatgggctgctgggacatgtaccgtcatgacattgactgccagtggata
gacatcaccgatgtgccccctggagactacctgttccaggttgtcattaaccccaactat
gaagtgccagaatcagatttctctaacaacatcatgaagtgcaggagccgctatgatggc
taccgcatctggatgtacaactgtcacgtaggtggagccttcagtgaggagacagaacag
aagttcgaacacttcagtggacttctaaataaccagctctctgtacagtaa

DBGET integrated database retrieval system