KEGG   Mus musculus (mouse): 97064Help
Entry
97064             CDS       T01002                                 

Gene name
Wwtr1, 2310058J06Rik, 2610021I22Rik, C78399, Taz
Definition
(RefSeq) WW domain containing transcription regulator 1
  KO
K16820  WW domain-containing transcription regulator protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    97064 (Wwtr1)
   04392 Hippo signaling pathway - multiple species
    97064 (Wwtr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WW
Motif
Other DBs
NCBI-GeneID: 97064
NCBI-ProteinID: NP_598545
MGI: 1917649
Ensembl: ENSMUSG00000027803
Vega: OTTMUSG00000029047
UniProt: Q9EPK5
Structure
PDB: 

Position
3; 3 D
AA seq 395 aa AA seqDB search
MNPSSVPHPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGGPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKVMNQPLNHVNLHPSITSTSVPQR
SMAVSQPNLAMNHQHQQVVATSLSPQNHPTQNQPTGLMSVPNALTTQQQQQQKLRLQRIQ
MERERIRMRQEELMRQEAALCRQLPMETETMAPVNTPAMSTDMRSVTNSSSDPFLNGGPY
HSREQSTDSGLGLGCYSVPTTPEDFLSNMDEMDTGENSGQTPMTVNPQQTRFPDFLDCLP
GTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgtcctcggtgccccatccgctcccgccgccagggcagcaagtcatccacgtc
acgcaggacctggacaccgacctcgaagccctcttcaactctgtcatgaaccccaagccc
agctcatggcggaaaaagatcctcccggagtccttctttaaggagcccgattccggctcg
cactcgcgccaatccagcacagactcatcaggcggccacccggggcctcgactagctggc
ggcgcgcagcacgtccgctcgcactcgtcgcccgcatccctgcagctgggcaccggtgcg
ggagccgctggaggccctgcacagcagcatgcacatctccgccagcagtcctatgacgtg
accgacgagctgccgttgccccccgggtgggagatgaccttcacggccactggccagaga
tacttccttaatcacatagagaaaatcaccacatggcaagaccccaggaaggtgatgaat
cagcctctgaatcatgtgaacctccacccgtccatcacttccacctcggtgccacagagg
tccatggcagtgtcccagccgaatctcgcaatgaatcaccaacaccagcaagtcgtggcc
actagcctgagtccacagaaccacccgactcagaaccaacccacagggctcatgagtgtg
cccaatgcactgaccactcagcagcagcagcagcagaaactgcggcttcagaggatccag
atggagagagagaggattaggatgcgtcaagaggagctcatgaggcaggaagctgccctc
tgccgacagctccccatggaaaccgagaccatggcccctgtcaacacgcctgccatgagc
acagatatgagatctgtcaccaacagtagctcagatcctttcctcaatggagggccctat
cattcacgggagcagagcacagacagtggcctggggttagggtgctacagtgtccccaca
actccagaagacttcctcagcaacatggacgagatggatacaggtgaaaattccggtcag
acacccatgaccgtcaatccccagcagacccgcttccctgatttcctggactgccttcca
ggaacaaatgttgacctcgggactttggagtctgaagatctgatccctctcttcaatgat
gtagagtctgctctgaacaaaagcgagccctttctaacctggctgtaa

DBGET integrated database retrieval system