KEGG   Mus musculus (mouse): 97086
Entry
97086             CDS       T01002                                 

Gene name
Slc9b2, C80638, NHA2, NHE10, Nhedc2, nha-oc, nhaoc
Definition
(RefSeq) solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2
  KO
K23994  solute carrier family 9B (sodium/hydrogen exchanger), member 1/2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    97086 (Slc9b2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   97086 (Slc9b2)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 97086
NCBI-ProteinID: NP_849208
MGI: 2140077
Ensembl: ENSMUSG00000037994
Vega: OTTMUSG00000030292
UniProt: Q5BKR2
Position
3; 3 G3
AA seq 547 aa
MEDEDKTAECQHSKPPTGITHEAPPHHELQEERVMSLRGTDRSEPTEGSNLLTSGEKKPQ
DSPTEPNGLQSLRRFLACPPRGCLARVITNGTMVVLLWAMVWSVTGPECLPGGNLFGIII
LFYCSITGGKLFGLIKFPTLPPLPPLLGMLLAGFLLRNIPVINDSVRIQHKWSSSLRSIA
LSVILVRAGLGLDSKALRKLKGVCVRLAMGPCIVEACASAILSHFLMGLPWQWGFILGFV
VGAVSPAVVVPSMLLLQEGGYGVGKGIPTLLMAAGSFDDILAITGFNTCLGVAFSTGSTV
FNIFRGILEVVIGVAAGSFLGFFIQYFPSRDQDNLVWKRAFLVLGFAVLAVFSSVYFSFP
GSGGLCTLVMAFLAGMRWTDKKSEVEKVIAVTWDVFQPLLFGLIGAEVSIVSLRAETVGL
CVATLSIAVLIRILTTFLMVCFAGFNIKEKIFISFAWLPKATVQAAIGSVALDTARSHGE
KQLEDYGMDVLTVAFLAILITAPIGSLLIGLLGPRVLQKSEHRTEEEVQGETSAHIQRKP
EDSITEA
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggaggatgaagataagacagctgaatgtcagcattcaaagccacctacggggatcaca
cacgaggctcctccacatcacgaactacaggaagagagagtcatgagcctcagaggtaca
gacagaagtgaaccgacagaaggcagtaacctgctgaccagcggtgaaaaaaagccacag
gactcaccaacagaacccaatggcctgcagagtctgaggcgattcctggcctgccctcca
cgaggctgcctggcaagagtgataacgaacggtaccatggttgttcttctgtgggccatg
gtttggtcagttaccggccctgaatgtcttcctggaggaaatctgtttggaattatcatt
ctgttctattgttccatcaccggaggtaaactttttggactcattaagtttccaacattg
cctcctctgcctcctcttcttggcatgctgctagctgggtttctcttgaggaatatccca
gtcatcaatgatagcgtccggatccaacacaagtggtcgtcatctttgagaagcatagcc
ctttctgtcattctggttcgtgctggccttggtctagattcaaaggccctgaggaagctg
aagggtgtgtgtgtgcgactggccatgggtccctgcatcgtggaggcgtgtgcttctgcg
attctctcacacttcctgatggggttgccatggcaatgggggttcatcctgggttttgtc
gtaggtgccgtgtccccagctgtcgtggtgccctccatgctccttttgcaggaaggaggc
tacggtgttggaaaaggtatcccaaccttactcatggccgccggcagcttcgatgacatc
ctggccatcactggcttcaacacgtgcttaggcgtggccttttccacaggatctacagtt
tttaacatcttcagaggcatcttggaggtggtaattggtgtggcagctggatcttttctt
gggttttttatccagtacttcccgagcagggaccaggacaacctcgtgtggaagcgagcc
tttctggttctgggttttgctgtgctcgctgtgttcagcagtgtgtattttagcttcccg
gggtctggaggactctgcacgttggtcatggctttcctagcaggcatgaggtggactgac
aagaagtcagaggtagaaaaggtcattgcagttacctgggacgttttccagcctcttctt
tttggcctgattggagcagaggtttccattgtgtctctcagagcagaaacggttggcctt
tgtgttgcaaccctcagcatcgcagtgcttatacgaattctgactacattcctgatggtg
tgtttcgctggctttaacataaaggaaaagatatttatttcttttgcctggcttccaaag
gccacggtccaggctgccattggctctgtggctctggacacggcaagatcccacggagag
aagcagctggaagactatgggatggatgtgctgacggtggcatttttggccatcctcatt
acagcaccaattggaagcctactgattggtttgctgggtcccagggttcttcagaaatct
gaacatcgaaccgaagaggaggttcaaggagagacttctgcacacattcagaggaagcct
gaggattccattacggaagcctga

DBGET integrated database retrieval system