KEGG   Mus musculus (mouse): 97114
Entry
97114             CDS       T01002                                 

Gene name
H3c15, H3-614, H3.2-614, H3c13, H3c14, H3c2, H3c3, H3c4, H3c6, H3c7, Hist2h3, Hist2h3c2, Hist2h3c2-ps, Hist2h3ca1, M32461
Definition
(RefSeq) H3 clustered histone 15
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    97114 (H3c15)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    97114 (H3c15)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    97114 (H3c15)
  09165 Substance dependence
   05034 Alcoholism
    97114 (H3c15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    97114 (H3c15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    97114 (H3c15)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    97114 (H3c15)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   97114 (H3c15)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 97114
NCBI-ProteinID: NP_473386
MGI: 2448357
Ensembl: ENSMUSG00000081058
Vega: OTTMUSG00000021934
UniProt: P84228 B9EI85
Structure
PDB: 
5IX2

Position
3; 3 F2.1
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtacgaagcagactgcccgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcaccgtggcgctgcgggagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
acggacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac
ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaaacgcgtcaccatc
atgcccaaggacatccagttggcccgccgcatccgtggggagcgcgcttaa

DBGET integrated database retrieval system