KEGG   Mus musculus (mouse): 97159
Entry
97159             CDS       T01002                                 

Gene name
A430005L14Rik, C79672
Definition
(RefSeq) RIKEN cDNA A430005L14 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: UPF0688
Other DBs
NCBI-GeneID: 97159
NCBI-ProteinID: NP_780496
MGI: 2140680
Ensembl: ENSMUSG00000047613
Vega: OTTMUSG00000010500
UniProt: Q80WR5
Position
4; 4 E2
AA seq 230 aa
MRSRKLTGGVRSSARLRARSYSSASLASARDVTSSTSAKTTCLASSSHKATDRRTSKKFK
YDKGHLVKAELQKLDPKSDISSLPKVAPVAPCENKFAEDSAEAAVSVPESREPPQGCSTP
ASEEPSVKAENGLSTEPSSAAAAQEPDDSSAGQAEPVPRTEEVRASVLQMDSSIFLDDDS
NQPMPVSRFFGNVELMQDLPPASSSYPSMSRREFRKMHFRAKDDEDDAEG
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaggagcaggaagcttacaggtggagtgcggtcctcagcacgccttcgggcccggagt
tactcttcagccagcttggcctctgccagggacgttaccagctccacatctgctaaaaca
acatgtctggcttcctcatcacacaaagctacggacagacgaacttccaaaaagttcaag
tatgacaaaggtcaccttgtgaaggcagaattacaaaaacttgaccctaagagtgacatt
tcttctttgccaaaagtggcccccgtggctccttgtgaaaataagtttgcggaggacagt
gctgaggctgctgtctctgtaccagagagcagagagccgcctcagggctgctccacgcct
gcgagtgaggaaccctcagtaaaggctgagaatggcctgtccacagaacccagcagtgcc
gctgcagcccaggagcccgatgacagctctgccggacaggcagagcctgtgcccaggaca
gaggaggtgcgggcatccgtgcttcagatggacagcagcatctttctagatgatgacagc
aaccagcccatgcctgtgagtcgcttcttcgggaatgtcgagcttatgcaggatctgcca
ccagcctcttcatcttatccttccatgagcagaagagaattcagaaaaatgcacttcaga
gccaaagatgacgaggatgacgctgaggggtag

DBGET integrated database retrieval system