KEGG   Mus musculus (mouse): 97187Help
Entry
97187             CDS       T01002                                 

Gene name
C85819
Definition
(RefSeq) expressed sequence C87977
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MITF_TFEB_C_3_N
Motif
Other DBs
NCBI-GeneID: 97187
NCBI-ProteinID: NP_001171013
MGI: 2140708
Ensembl: ENSMUSG00000046262
Vega: OTTMUSG00000010543
UniProt: A2A958
Position
4; 4 E1
AA seq 498 aa AA seqDB search
MVICRHCPDQDDSLEEVTEESYSPPTLQNLAIQSLLRDEALAISALTDLPQSLFPIIFEE
AFTDGHIGILKAMIPAWPFPYLSLGKQINNCNLETLKAMLEGLDILLAQKVQTSRCKLRV
INWREHDLKLWAGSHEGEGLPEFTTEKQPIENSPGCEVKKELKVTTEVLLMKGRLDESTT
YLLQWAQQRKDSIHLCCRKLVIQGLTKASVIEIFKTVHADCIQELILRCICIEELAFLNP
YLKLMKSLFTLTLDHIIVTSSFGDSEKLDEEIIFSLISQLPTLHCLQKLYVNHVPFIKGN
LKEYLRCLKKPLETLCISNCDLSQSDLDYLPYCLNICELKHLHLSDICLRDLLLEPLGFL
LERVGDTLKILELESCCIVDFQFSALLPALSQLSHLREVSFYDNNVSLPFLKQLLHHTAL
LSQLIYECYPAPLECYDDSGVILTHRLESFCPELLDILRAKRQLHSVCFETTQCSKCGGL
YIYDKETQCCHFVGVILA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtgatctgtcgccattgtccagatcaggatgactctttagaagaagtcacagaggaa
tcctattctccacccaccctccagaacctggcaattcagagtctactgagggatgaggcc
ttggccatttctgctctcacggacctgccccagagtctgttcccaataatttttgaggag
gccttcactgatggacatatagggatcttgaaggccatgatacctgcgtggcccttccca
tacctttctttagggaagcagataaataattgcaacctggagactttgaaggctatgctt
gagggactagatatactgcttgcacaaaaggttcaaaccagtaggtgcaaactcagagta
attaattggagagaacatgacttgaagttatgggctggatcccatgaaggtgaaggctta
ccagagttcacgacagagaagcagccaattgagaacagtcctgggtgtgaggtgaagaaa
gaattgaaggtgacgactgaagttcttctcatgaagggaagacttgatgaatctaccaca
tacttgctgcagtgggcccagcagagaaaagattctattcatctatgctgtagaaagcta
gtaattcaaggcttaaccaaagcctcggtgatagaaatcttcaaaactgtacacgcagac
tgtatacaggagcttatcctaagatgtatctgcatagaagagttggcttttcttaatccc
tacctgaaactgatgaaaagtcttttcacactcacactagatcacatcatagttacctcc
agttttggtgattctgaaaagcttgatgaggagataatattcagcttgatttctcaactt
cccacactacactgtctccagaaactctatgtaaatcatgtcccttttataaaaggcaac
ctgaaagaatacctcaggtgcctgaaaaagcccttggagacactttgcatcagtaactgt
gacctctcacagtcagacttggattacctgccctattgcctgaatatttgtgaactcaaa
catctgcatcttagtgatatatgtctacgtgatttactccttgagcctcttgggtttctc
cttgagagagttggagataccctgaaaatcctggaattggagtcatgttgtatagtggac
tttcagttcagtgccttgctgcctgccctaagccaattatctcacctcagagaggtcagt
ttctatgataataatgtctctctgcctttcttgaaacaacttctacaccacacagccctg
ctgagtcagctgatctatgagtgttaccctgcccctctggagtgctatgatgacagtggt
gtaatactaacacacagattagaaagtttttgtcctgagctcctggatatactcagagcc
aaaagacagctccatagtgtctgctttgaaacaacccaatgctctaaatgtggtgggtta
tacatttatgataaggagacccaatgttgccattttgtgggagtaatattagcttaa

DBGET integrated database retrieval system